KEGG   Sulfurisphaera tokodaii: STK_04900
Entry
STK_04900         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: NAD_binding_8 Pyr_redox_2 Pyr_redox_3 DAO HI0933_like GIDA Lycopene_cycl Pyr_redox DUF4488 FAD_binding_3 FAD_binding_2
Other DBs
NCBI-ProteinID: BAB65483
UniProt: Q975B8
Position
complement(488441..489436)
AA seq 331 aa
MDIGVIGAGPAGLALAWFLKGTKYNVTVYEGLNDVGLKPCAWGLISGIEDYVPITKEAII
SEIKGFRIYLDDKLVHDIRVNKKLGYIINKPIFLKNIAEKVEVKYNIKIIEKDGEYFTTE
GTKIIADKMIYANGHYSLPKDNTIPAIQYITDYQIDKEIVEFYFYSDLLGYAWIFPDENG
SKIGIGGWADIPFLKERIKRILKGKILNFHGARVSDFGILEERLNGRFIGEALGTVYPLT
GEGIRPSIISAKLLADSLLNEKNFEREFKKSKLYWTIQTQAKIVHGVKKGYMSLKGLSRI
MTKSDPNLVLKVAIGDFDSFDIIKLFGRMII
NT seq 996 nt   +upstreamnt  +downstreamnt
atggatattggtgtaataggggcaggtcctgcgggattagcattagcatggttcttaaag
ggtaccaaatataacgttacagtctatgaaggacttaatgatgtaggtctgaaaccatgt
gcatggggattaatttctggtattgaagattatgtaccaataactaaagaggctattata
agtgaaataaaaggatttaggatataccttgatgataaactagtacatgatattcgagta
aataaaaagttaggatatataataaataagccaatttttcttaagaatattgctgaaaag
gtagaggtaaaatataacataaaaataatagaaaaagacggcgagtattttactacagaa
ggaacaaaaataattgcagacaaaatgatttatgctaacggtcattactcattacctaaa
gataacacaattcccgccattcaatatataactgattaccaaatagataaagaaatagta
gaattctatttctatagtgatttattaggttacgcatggatatttccagacgaaaatgga
agtaaaattggaattggaggatgggctgatataccctttcttaaagagagaataaagaga
attttaaagggaaaaatactcaattttcatggagcaagagtatcagattttggtattcta
gaagagagattaaacgggagatttataggtgaagccttaggcactgtatatcctctaact
ggagaaggaattagaccctcaataatatcagcaaaactcttagcagattcattgctcaat
gagaaaaatttcgagagggagtttaaaaaaagcaaattatattggaccatccaaactcag
gctaaaattgttcatggcgttaaaaaaggatatatgagtttaaagggactatctagaatt
atgacaaaaagtgatcctaatctagtcttaaaagttgctatcggtgacttcgattcattt
gatattattaagttatttgggaggatgattatatga

DBGET integrated database retrieval system