KEGG   Sulfurisphaera tokodaii: STK_04940
Entry
STK_04940         CDS       T00062                                 
Name
(GenBank) geranylgeranyl reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00564  Glycerophospholipid metabolism
sto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    STK_04940
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     STK_04940
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     STK_04940
SSDB
Motif
Pfam: DAO FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 GIDA NAD_binding_8 Trp_halogenase Lycopene_cycl Pyr_redox HI0933_like Thi4 UDPG_MGDP_dh_N 3HCDH_N NAD_binding_9
Other DBs
NCBI-ProteinID: BAK54305
UniProt: F9VN08
Position
491365..492726
AA seq 453 aa
MKELKYDVLIIGGGFAGASTAFHLAGKGLKVLLVDSKPWNRIGDKPCGDAVSKAHFDRLG
MPYPKGEELENKISGIKLYSPDMKTVWTVNGEGFELNAPLYNQRILREAESKGVEIWDQT
TAMKPFFENGFVKGAVLYNRRSNEEVAVYSKVLVDATGYSRSVRSKLPQELPIAEDLDEK
DADIAYREVLLTRDDIEDHDYLRIFVTQKASPGGYWWYFPKGKNKVNVGLGIQGGMGYPS
VHVFYQKYLDSYAPDVDKSRLLVKGGALVPTRRPLYTMVWNGIIAVGDSAYTVNPVHGGG
KGSAMISGYCAAKTILNAFEKGDFSAQGLWDMNICYINEYGAKQASLDIFRRFLQKLSDD
DINYGMNKKVLKEEDLLEASEKGDLHLSVAEKAMRIIAGLGRPSLLMKLKTVAEYMKNIK
QLYYNYPRSPSGLQIWKTQVDSLISEFNMNISK
NT seq 1362 nt   +upstreamnt  +downstreamnt
ttgaaggagttaaaatatgatgtactcattattggaggaggttttgccggagcatcaaca
gcttttcatttggctggaaaaggattaaaagtgctattagttgatagcaaaccgtggaat
agaattggagataaaccatgtggtgatgcagtaagtaaggcgcatttcgataggcttgga
atgccttatcctaaaggtgaagaattagagaataagattagcggtataaaactgtatagt
ccagatatgaaaactgtatggactgtaaatggagaaggatttgagctaaatgctcctctt
tataatcaacgaatacttagagaagctgagagtaaaggcgtagaaatatgggatcaaact
actgcgatgaaaccattctttgaaaacggctttgttaaaggtgcagtattatataataga
agaagcaatgaagaagttgctgtatattcgaaagttttagttgatgcaacgggatattca
agaagtgtaagaagcaaattaccgcaagaattacctattgcagaagatctagatgaaaaa
gatgctgatattgcgtatagagaggtattattaactagagatgacattgaagatcacgat
tacctgagaattttcgttacacagaaagcttctcctggcggatactggtggtattttcct
aaaggcaagaataaagttaatgtaggactaggtattcaagggggaatgggttatcctagt
gttcatgtcttttaccaaaaatatttagactcatatgccccggatgttgacaaatcaagg
cttttagttaaaggaggggctttagttccaacaagaagaccattatatacaatggtgtgg
aatggtattatagctgttggagattctgcatatactgtaaatccagttcacggaggaggg
aagggttcagccatgatatccggttattgtgcagctaaaactatacttaatgcttttgaa
aaaggtgacttttcagctcaaggattatgggatatgaatatatgttatataaatgaatat
ggagcaaaacaagctagccttgatatatttagaagatttttacagaaactcagtgatgat
gatataaactatggaatgaacaagaaagttctaaaagaggaggatttacttgaagcaagt
gaaaaaggtgatcttcacttatcagtagcggaaaaagctatgaggataattgcaggatta
ggtagaccttctctattaatgaaattaaaaacagtagcagaatacatgaaaaatattaag
caattatattataattatcctagatccccatctggcttacaaatatggaaaactcaagtt
gatagtttaatctcagaatttaatatgaacattagtaagtaa

DBGET integrated database retrieval system