KEGG   Sulfurisphaera tokodaii: STK_04970
Entry
STK_04970         CDS       T00062                                 
Symbol
sdhA
Name
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase flavoprotein subunit [EC:1.3.5.1]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00020  Citrate cycle (TCA cycle)
sto00190  Oxidative phosphorylation
sto00650  Butanoate metabolism
sto00720  Carbon fixation pathways in prokaryotes
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
Module
sto_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sto_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sto_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STK_04970 (sdhA)
   00650 Butanoate metabolism
    STK_04970 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    STK_04970 (sdhA)
   00720 Carbon fixation pathways in prokaryotes
    STK_04970 (sdhA)
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     STK_04970 (sdhA)
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO FAD_binding_3 HI0933_like Pyr_redox_2 NAD_binding_8 Thi4 GIDA Lycopene_cycl FAD_oxidored Pyr_redox TMP-TENI AlaDh_PNT_C Pyr_redox_3 3HCDH_N
Other DBs
NCBI-ProteinID: BAK54307
UniProt: F9VN10
Position
495426..497126
AA seq 566 aa
MEKVSYDVVIVGAGLAGLMAAHEIASAGYNVAVISKVFPTRSHSAAAEGGIAAYIQGNSD
PNDNPDYMAYDTIKGGDYLVDQDAAELLAYKSGEIVMLLERWGTLFNRQPDGRVAVRYFG
GQTYPRTRFVGDKTGMALLHTVYERTSGLGSVDFYFEWFAWELVRDENRVRGIIAFDMRN
MVPVFFKAKAVVIASGGMGMLYRHSTNSYINTGDGYAMALRARVALKDPEFVQFHPTALY
PSDILISEAARGEGAVLRNVKGERFMARYAPKKLDLAPRDIVSRAILTEVKEGRGFPGGY
VGLDLTHLGEDYIKERLALAYEAAKSFAGLDATKEMIPVRPAQHYYMGGIDVDITGRNPD
LIGLFAAGEAACVSVHGANRLGSNSLLETLVFGRETGRAVVEFLKSYTEPSSDIDKEAEK
MIDSAYDVVKSESGIHFGEILEKLRDTMWDYVGVFRDENGLKTALSEIMKLREDMKKMYV
LDKSKVYNTEFYNALELKNMLDLALVIATSALNRKESRGAHYRLDFPERDDQNWLKHTIA
YLRGNSVEITYKPVKMTKWKPEARVY
NT seq 1701 nt   +upstreamnt  +downstreamnt
gtggagaaagtttcatacgatgttgtaatcgtaggagctgggttagctggattaatggca
gcacacgagatagcttcagcaggttataacgtagcagtaatctctaaagtattccctacc
agatcacattcagcggctgctgaaggaggaattgcggcctacattcaaggcaattcagat
ccaaatgataatccagattatatggcttatgatactatcaaaggaggcgattatttagtc
gatcaagatgctgctgaactcttagcatataagtctggagagatagtgatgcttctagaa
agatggggaactttatttaataggcaaccagatggacgagttgctgtgagatattttggt
gggcaaacttatcctagaactagatttgttggagataagactggaatggcactattgcat
acagtatatgaaagaacttctggtttaggtagtgtagatttctattttgaatggtttgca
tgggaattagttagagatgagaacagggttagaggtattatagcttttgatatgaggaat
atggttccagtatttttcaaagcaaaagctgttgtgatagcttccggaggtatgggaatg
ttatataggcattcaaccaatagttatatcaatactggtgacggttatgctatggcatta
agagcaagggtcgcattaaaagatccagaatttgttcaattccatcctacagcattgtat
ccctcagatatcttaattagtgaagctgcaagaggtgagggggcagtactaagaaacgtt
aaaggagaaagatttatggcaagatacgcccctaaaaaactggatcttgcccccagggat
atagtttctagagcaatacttactgaagtaaaagaaggaagaggatttccgggagggtat
gtaggcttagatcttactcatttaggtgaggattatattaaggagagattagccctagct
tatgaagcagcaaagagctttgcagggttagatgcaaccaaagagatgattccagtaagg
cctgctcaacattattatatgggaggtattgatgtagatataactggtagaaatccagat
ttgataggattatttgcagcaggagaagcagcatgtgtttcagtacatggtgccaacaga
ttaggttctaactctttgttagaaactttagtatttggtagagaaacaggaagggctgta
gtcgaatttcttaaaagttacactgaaccttcttccgatattgataaagaagctgaaaaa
atgattgactcagcttatgacgtagtaaaaagtgaaagcggtattcattttggagaaata
ttagaaaaattgagagatactatgtgggattacgttggtgtgtttagggatgaaaatgga
ttaaaaactgctctttcagaaattatgaaactaagagaagatatgaaaaaaatgtatgta
ttagataagagtaaggtctataacacagaattttataatgctcttgagcttaagaacatg
ttagatctagcccttgtaatagctacttctgctttaaacagaaaagaatcaagaggagcc
cactataggttagatttcccagaaagagatgatcagaactggctcaaacatacgatagca
tatctgagaggtaatagtgtagagattacatataaacctgtaaaaatgacaaaatggaaa
ccagaagctagggtgtattaa

DBGET integrated database retrieval system