KEGG   Sulfurisphaera tokodaii: STK_05050
Entry
STK_05050         CDS       T00062                                 
Symbol
thrB
Name
(GenBank) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00260  Glycine, serine and threonine metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01230  Biosynthesis of amino acids
Module
sto_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STK_05050 (thrB)
Enzymes [BR:sto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     STK_05050 (thrB)
SSDB
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Other DBs
NCBI-ProteinID: BAB65500
UniProt: Q975A7
Position
504513..505433
AA seq 306 aa
MIVKAFSSSANLGAGYDILALAHDAFEDTIEIYAQNSSELDIKVEGNGVPLSIDKNSASF
ALLELLRSYDIKAKIRLKIIKGIPAGLGLGSSGASAAAAVYAANEIFKLNLSRQELVNFA
MKGEIASSGSPHPDNVAASLVGGLVSVLNSNPVKVEQVPLNLEFQIILIIPFVRIEAKTK
KAREMVPKQIDTSKYVTNARYLSSLLLGFIKGDRELVRLGLNDEIIEKAREPLFPHYPKI
KEISLLYDAIGACVSGAGPTIAIFVDSKSDKNKILGESLNVCKAYGYECTYKIAKVSGGA
WVERRD
NT seq 921 nt   +upstreamnt  +downstreamnt
atgattgtaaaagctttctcgtcatcggcaaacttaggtgcaggttatgatatactagct
ctggcacatgatgcttttgaagatacaattgaaatttacgctcaaaattctagtgaatta
gatataaaagtagagggaaatggtgtaccactatcaatagataagaattcagctagtttt
gctttgcttgaattgctaaggtcatatgatattaaagcaaagattaggttaaagattata
aaagggattccagctggtttgggcttaggtagtagtggcgcgtctgctgccgctgcggtt
tatgcggccaatgagatttttaaacttaatttaagccgacaagaattagttaactttgct
atgaaaggggaaatagcctcatctggttctccacatccagacaatgtagcagcaagtctg
gtgggcggtctagtaagtgtattaaattctaatcccgttaaggttgagcaagtacctctc
aatcttgagtttcaaataatacttattataccatttgttagaatagaagcaaaaactaaa
aaagcaagagagatggttccaaaacaaattgatacatctaaatatgttactaatgctaga
tatctatcatctcttttactaggcttcattaagggtgatagagaattggttaggttaggt
ttaaatgatgaaattattgaaaaagctagagaacccttattccctcactatcccaaaata
aaggaaatttcactattatatgatgctatcggtgcatgcgttagtggtgctggtccaaca
attgctattttcgttgattcaaagtcagataaaaataaaattcttggggaatcacttaat
gtttgtaaagcttatggatatgaatgcacatataaaatagctaaagtttcaggaggtgca
tgggttgagagaagggactaa

DBGET integrated database retrieval system