KEGG   Sulfurisphaera tokodaii: STK_05250
Entry
STK_05250         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: HD_3 YfbR-like HD HDOD SAM_LFY
Other DBs
NCBI-ProteinID: BAB65520
UniProt: Q974Y7
Position
complement(521893..522432)
AA seq 179 aa
MSLERVIIGCKNLVRTGWMQRGVPPSIGETVSQHSWEAAVLAYYLASKLKEKGVKINPER
ASVIALFHDVAESLLGDLPKWASERIEEKEEIELEAIKELGLDVELFIEYKEMKSLEGKI
AKLCDRLSTYMQAKRYAKLGYDVSEIIKTYEKEIENLMKDEKLSLIINEINNLIKNING
NT seq 540 nt   +upstreamnt  +downstreamnt
atgagtttagaaagagttattataggatgtaaaaatttagttagaactggttggatgcaa
agaggagtaccgccatcaataggagagacagtatcccagcatagttgggaagcggctgtt
ttagcatattatcttgctagtaagcttaaggaaaaaggtgttaagattaatcctgaaaga
gcatcagtgatagcattatttcatgacgttgctgagagtttgctaggagatttaccaaaa
tgggcttctgagagaatagaagaaaaggaggaaatagaacttgaagctattaaagaacta
ggtctggatgttgaattattcatagaatataaggaaatgaaaagcttagaaggaaagatt
gcaaaattatgtgatagattatctacatacatgcaagcaaagagatatgctaaattaggt
tatgatgttagtgaaataatcaaaacctacgaaaaggaaattgaaaacctcatgaaggat
gagaaattatctttgattattaatgagataaataacttgataaagaatataaatggctaa

DBGET integrated database retrieval system