KEGG   Sulfurisphaera tokodaii: STK_05290
Entry
STK_05290         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Fer4_8 FAD_binding_4 Fer4_7 Fer4_17 Fer4_21 Fer4_9 Fer4_10 Fer4_2 Fer4_6 Fer4 4HB
Other DBs
NCBI-ProteinID: BAB65524
UniProt: Q974Y3
Position
complement(524938..527214)
AA seq 758 aa
MRVTDASIFSRALTTIEIKEIEKLLIKEDKEVVIGRLTSMNGDIIKYSNPKIIPSPTKLP
SGNIIEEIKSDSSIYSIYRVAPGLTFEELISELKKYSKVPVLFPLYLQGSIGGFIATNGS
GFGSYKFGFVRGKKEVHSLKDNEAIVMTANYTEVIESDKESKFAWSAIILDDKERFYLTS
NYAKLEGISGSSIDTYSLINDINKIVIQSFKRDYIPVMLRFPESSYSKLAQLKFFEKIIG
YKINFNSPDKYYVFLGRIKFDDLNELFSFLKKNKDFLPFPSLSEYDKLHLEILNKLGKKT
KLPKEYKSIVSIYNEATKCINCGLCLNVCKAYEVTHNPLYSPVGKIGRLIMEEKDFETCF
GCVKDEEVCPVNIPISKLTTEGVNIISPEKIKIEIQDLPSDIPNLAKKLQNTYRNRPLYL
LFVGCASKYDINGVRGFLTYLLDKGNSLPQDFSPRVELVNACCGFDDFIGGNIQGAKDKV
SKILELKKNKNAQGIYFLCPEALYIYNLLSGDTGILAYEVVKDALKERKIHAGCWAKKLG
IKGNDDECAGLNLTTYKGYPIPSKGKAVLTICPFSTWKYGTSSVYSVFYVGSENMEKLVG
EKDLDNLLLDLSIDSIKEALTDSVDEIAEKVSLWNLGGEGYFILVTYPVILNKFKNILEQ
KIKEHERKDEMIKYISKIVNDTIILDQKITLISDYLRGQNYSSLIMEMREKILTSSKLEY
SAKDLVNSDQMIKAIDEMIKRAITPKLIERVFKEIIYS
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgagagttactgatgcatcaatctttagtagggctttgactactattgaaatcaaagaa
atagaaaaacttcttatcaaggaagataaagaagttgtaattggaagacttacctcgatg
aatggggacattataaaatattctaaccctaaaattattccttcacctacaaaattacct
tctgggaatataatagaagaaatcaaatccgattcttctatttattctatttatagagta
gcaccaggacttacatttgaagaacttatatccgaattaaagaaatactcaaaagtacca
gtactttttccattatatctgcaaggaagcataggagggttcatagcaactaatgggtct
ggatttggaagttacaaatttggttttgtaagaggaaagaaagaggttcacagtcttaaa
gataatgaagcaatcgttatgacagcaaattatacagaagtaattgaaagtgataaagaa
agtaagtttgcatggagtgcaattatactagatgacaaagaaagattttatttaacttct
aattatgcgaaactggaaggtatttctgggagtagtattgatacttactctttaattaac
gatataaataaaattgttatacagagctttaaaagagattatataccagttatgctcaga
tttccagagtcttcatattctaagttagctcaattaaaattttttgaaaaaattatagga
tacaaaataaattttaattcaccagataaatactatgtatttttaggacggattaagttt
gatgatttaaacgagcttttctcttttttaaagaaaaataaagacttcttacctttcccc
tcactttctgaatatgacaaattacatttagagattttaaacaaattaggaaagaagact
aaattgccaaaagagtataagagcatagttagcatatataacgaggcaactaaatgtatt
aactgtggattatgccttaatgtttgtaaagcatacgaagtcacccataaccctctatat
tctccagttgggaaaattggtagacttataatggaggaaaaggattttgaaacttgcttt
ggatgtgtaaaagatgaagaagtatgcccagtaaatataccaattagtaaattaactact
gaaggggtaaatattatttctccagaaaaaattaaaatagaaatacaagatttaccttca
gatatccctaacctagcaaaaaaacttcaaaatacttatagaaataggcctttgtatttg
ctctttgtaggatgcgcatctaaatatgatataaatggtgttagaggttttttaacatac
ttgttagataaaggaaactctttgcctcaagacttttctcctagagtagaattagtaaat
gcttgttgcggttttgatgattttattggagggaatattcaaggtgctaaagataaggta
agtaaaattttagaattaaagaaaaataaaaatgcccaaggtatttatttcctctgtcca
gaagcattatacatttacaatttactatctggagatacgggtatattagcatatgaagtt
gtaaaagatgcattaaaagaaagaaaaattcatgctggttgttgggctaaaaaactagga
attaaaggaaatgatgatgaatgtgctggattaaatttgactacatataagggatatcca
ataccttctaagggaaaagctgtgctaacaatttgtccattttctacatggaaatatggt
acttcatctgtatattccgtattttatgtaggatctgagaatatggagaagcttgttgga
gaaaaagatttagataatttattactagatctatcaattgattcaattaaagaagcctta
acagactcagtagatgaaattgcagagaaagttagcttatggaacttaggcggtgaagga
tactttatccttgttacatacccagttattctaaataagtttaagaatatactagaacag
aaaataaaagagcacgaaagaaaggatgaaatgattaaatacatttcaaagatagttaat
gacactataatactagatcagaagattacattaatttcagattatttaaggggtcaaaat
tattctagtttaattatggagatgagagaaaaaattcttacttcaagtaaacttgaatat
tcggctaaagatctagtaaacagtgatcaaatgataaaagcaattgatgagatgataaaa
agagcaattacaccaaagcttattgaaagagtatttaaggaaataatatattcttaa

DBGET integrated database retrieval system