KEGG   Sulfurisphaera tokodaii: STK_05330
Entry
STK_05330         CDS       T00062                                 

Gene name
panB
Definition
(GenBank) 3-methyl-2-oxobutanoate hydroxymethyltransferase
  KO
K00606  3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00770  Pantothenate and CoA biosynthesis
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    STK_05330 (panB)
Enzymes [BR:sto01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     STK_05330 (panB)
SSDB
Motif
Pfam: Pantoate_transf PEP_mutase
Other DBs
NCBI-ProteinID: BAK54322
UniProt: Q974Y0
Position
complement(528743..529546)
AA seq 267 aa
MEKVTIRDFLKKKEKKEKIIMLTAYDYPSAKIISQTNLDGILVGDSLGMVVLGKENTLKV
TMRDMLIHLDAVVKAKPPQLIVADMPFLSYETSIKDAVKNAGLLARHGADAVKLEGGEEM
RDVVRAIVRAGIPVMGHIGLTPQRFLRIGGYRILGKREKEEEQLLKDAKTLEEAGAFSIV
IENTYSDVAKKITESISIPTICIGAGPYCDGQILVIHDLLGLSDFTPYFAKKYIDLRGLI
RRAIEDYISEVKEGKFPGKEHYKSRDS
NT seq 804 nt   +upstreamnt  +downstreamnt
atggaaaaggttacaataagggatttcttgaaaaagaaggaaaagaaagagaaaataata
atgttaacagcctacgattatccctcagcgaagataatatctcagacgaatcttgatggt
atcctagttggagactcccttggaatggtagttttaggaaaagagaacacacttaaagtg
actatgagagatatgttaattcatttagacgcagtagtaaaagctaagcctccacagtta
atagttgctgatatgccattcttaagctatgaaacgtcaatcaaagatgctgtaaaaaat
gccggattacttgctagacacggtgctgatgcagtaaaattagaaggtggagaggaaatg
agagatgttgttagggctatagtaagggctggaatacctgttatgggtcatataggatta
accccacaaagattcttaagaataggtggatatagaattttggggaaaagagaaaaagaa
gaggaacaattacttaaagatgcaaaaacactagaagaagctggggctttttcaatagta
atagaaaacacttactcagatgtggctaaaaagataactgaaagcattagtattccaacg
atatgtataggagcaggaccatattgtgacggacaaattttagttattcatgacttactt
ggtctttcagattttactccttattttgcaaaaaaatatatagatttacggggactaata
agaagagcaatagaggattatatttcagaggtaaaagaagggaaattcccaggaaaagaa
cattataaatctcgagatagctga

DBGET integrated database retrieval system