KEGG   Sulfurisphaera tokodaii: STK_05380
Entry
STK_05380         CDS       T00062                                 
Symbol
leuA
Name
(GenBank) 2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00290  Valine, leucine and isoleucine biosynthesis
sto00620  Pyruvate metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01210  2-Oxocarboxylic acid metabolism
sto01230  Biosynthesis of amino acids
Module
sto_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STK_05380 (leuA)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    STK_05380 (leuA)
Enzymes [BR:sto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     STK_05380 (leuA)
SSDB
Motif
Pfam: HMGL-like Radical_SAM
Other DBs
NCBI-ProteinID: BAB65534
UniProt: Q974X3
Position
complement(533701..534861)
AA seq 386 aa
MGCQFSVNSKKVRIFDTTLRDGEQAPGIDLTVEQKVKIARKLAELGVDVIEAGFPAASEG
EFIATKKILEEVGDQVEVIGLSRANKQDIDKTIDTGISSIHVFIATSDIHLKYKLKMTRE
QVLDKIYESVRYAKDHGLIVEYSPEDATRTDKDFLLKAVSTAIEAGADRINIPDTVGVMH
PFKFHDLIKDVVSVTKDKIVSVHCHNDFGLATANSIAGVMAGARQVHVTVNGIGERAGNA
SLEEVVMALKKLLGYEVNIKTYKLYETSRLVSELTGVPVPYFKAIVGENAFGHEAGIHVH
GVIENPLTYEPISPEEVGNFRRLALGKHSGIHGLKKLLEEQGIYLNDQELREVLNEIKKL
AENGEKVNVDVAKEIAIKVSSKKIKV
NT seq 1161 nt   +upstreamnt  +downstreamnt
ttgggatgtcaattctcggttaattcaaaaaaagttagaatatttgatacaacattaaga
gatggcgagcaagctccgggtatagatttaacagtcgaacaaaaagttaagatagcgaga
aaattggcagaactaggagttgatgtaatagaagctggttttcctgcagcttctgaggga
gaatttatagccactaagaaaatcctagaagaagttggagatcaggttgaggttatagga
ttatcaagggcgaataagcaagatatagataagaccatcgatactggcatatcaagcatc
catgtattcattgctacttctgatatacatctgaaatataaactaaaaatgacaagggaa
caagtactagataaaatttatgaatcagttagatatgctaaagatcatggcttaatagtt
gaatattccccagaagatgctacaagaactgataaggatttcttattaaaagctgtaagt
actgctattgaggctggggcagatagaataaatataccagatactgttggagttatgcat
cccttcaagtttcatgatttaatcaaagatgttgtttctgtaactaaagataaaatcgta
agtgtacactgccataatgattttggtttagcaacagctaactcaattgctggagtaatg
gctggggcaagacaagttcatgtaactgtgaatggaattggagagagagctggaaatgca
tcattagaagaagtagtgatggcactgaaaaaacttttgggatatgaggttaatatcaaa
acatataagttatacgaaacaagcagacttgtatcagagttaactggtgttcctgttccc
tattttaaagcgatagtaggagaaaatgcatttggtcatgaagctggcatccatgttcac
ggagttattgagaacccattgacatatgagccaatatctccagaggaggtaggtaatttc
agaagattagcactaggaaaacatagtggtatacatggtttgaaaaaacttcttgaggaa
caaggaatttacttaaatgatcaagagttaagagaagtattaaatgaaataaagaaactt
gctgaaaatggtgaaaaggtaaatgttgatgttgctaaagagatagctattaaagtaagt
agcaaaaagattaaagtatga

DBGET integrated database retrieval system