KEGG   Sulfurisphaera tokodaii: STK_05490
Entry
STK_05490         CDS       T00062                                 
Name
(GenBank) putative oxidoreductase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Amino_oxidase DAO NAD_binding_8 FAD_binding_2 Thi4 FAD_oxidored Pyr_redox_2 GDI GIDA HI0933_like Pyr_redox FAD_binding_3 MurD-like_N Trp_halogenase Pyr_redox_3 NAD_binding_9 Lycopene_cycl
Other DBs
NCBI-ProteinID: BAB65546
UniProt: Q974W1
Position
complement(542996..544549)
AA seq 517 aa
MNRIYDVVIIGGGHNGLVAASYLAKEGLKVAVFERRNVIGGATVTEELWPGIKVSTASYV
FSLFRKKIIDDLRLYDFGLKVYLKDPSLFVPFGQNKSITIWTSTKKTVKEIEKFSKKDAQ
SYEKFVKILEIFSEIADFLILNKPINLSEAEELLKLFKGLNVDENTALTIARMFFQDGKS
FLDEFFESEEVKSALIEDSVVGTYASPSTPGTAYVLLHHNFGEVNGVKGAWGYVEGGMGN
VSNALRRVAEYYGAEIFLNSEVDEIIVKNGEAKGIKLKNGKIIESKIVLSNADPKTTFLK
LLRNAELDEEFIRKVNALKTIGVSFKINGYIEELPDFGNGKSLRPEHIASELIIPSVSYV
EKAYLDAKNLGYSREPWLSINIPSTVDPTLAPQGKFVFTIFGQYVPYSKDLDKIKDKIAE
ISIEKVREFAPNFKPIKYEILTPLDIERRFGIWEGNIFHLDMTPDQLYFFRPLIGYSNYR
TPIKNLYLCGSGTHPGGGVTGAPGYNASMEILKDIKH
NT seq 1554 nt   +upstreamnt  +downstreamnt
gtgaatagaatttacgatgtagtaattataggtggaggtcataatggtttagttgcagca
tcctacttagcgaaagaaggtttgaaagttgcagtatttgaaagaagaaacgttataggt
ggtgcaacagtaactgaagaattatggcctggaattaaagtttccacagcatcatatgtc
tttagcttatttagaaaaaagataatcgacgatctaagactatatgatttcgggctgaaa
gtatatttaaaagacccaagtctgtttgtcccttttggacagaacaagagcataactatt
tggacttcaactaagaaaacagtaaaagaaattgaaaagttttcaaaaaaagatgcccag
tcttatgaaaaattcgtaaaaattctagaaattttctcagagatagcagatttcttaata
ttaaataaaccaataaacctctctgaagcagaagaattacttaaattatttaaaggttta
aacgtggacgaaaacacagcattgactattgcgaggatgtttttccaggacgggaagtca
ttcctagatgaattcttcgaaagtgaagaagtaaaatcagccttgatagaagattctgtt
gtaggaacttacgcttctccctctactcctggtacggcttatgtattacttcatcataat
ttcggagaggttaatggagttaaaggagcttggggttatgtggaaggaggaatgggaaat
gtatccaatgctcttaggagggttgcagaatattatggtgcagaaatttttcttaactca
gaagttgatgagataattgttaaaaatggtgaggctaaaggaataaaattaaaaaacgga
aaaataatagagagtaaaatagttctttctaatgctgatcccaagactacatttcttaaa
ctattaagaaatgctgaattagatgaagaattcattagaaaagtaaatgcacttaagact
atcggtgtatcatttaagataaacggatacatagaagaactcccagattttggaaatgga
aaatcattaagaccagagcatatagcttcagaactaattataccctctgtaagttacgta
gaaaaagcatatttagatgcaaaaaatttgggctattccagagaaccatggttatcaatt
aacatcccatcaactgtggatcctacgttagcacctcaagggaagtttgtcttcacaatt
ttcggccaatatgtaccttatagtaaagatcttgataagattaaagataagatagcagaa
atcagtattgaaaaagttagagaatttgcacccaattttaagcctattaaatacgaaata
ttaacgcctctagatattgaaagaagatttggaatatgggaagggaatatatttcatctt
gacatgacaccagaccaattatacttctttagacctctgataggatattctaattatagg
actccaataaagaacctatatctgtgtggatctgggactcatccaggtggtggtgttact
ggagcaccaggatataatgcctctatggagattttgaaagacataaaacattga

DBGET integrated database retrieval system