KEGG   Sulfurisphaera tokodaii: STK_05510
Entry
STK_05510         CDS       T00062                                 
Name
(GenBank) purine phosphoribosyltransferase
  KO
K07101  uncharacterized protein
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    STK_05510
SSDB
Motif
Pfam: Pribosyltran
Other DBs
NCBI-ProteinID: BAB65548
UniProt: Q974V9
Position
545764..546294
AA seq 176 aa
MVEYYVPKWEEIEEGILDVVEKMVNDDFVPDVIVAILTGGVIPAKLVADALGIRNIKYID
IKFYKGIESRERKPVIKAVYVDNLENKKVLIIDDVADTGETLDAVGNIITMYNPSLIRSA
TVYVKPWSRKYPDYYYKILDKWIIFPWDKWEVVRENTNAPIDKKEKYFDILRKLRK
NT seq 531 nt   +upstreamnt  +downstreamnt
atggttgaatattatgtacctaaatgggaagaaatagaagaagggattttagatgttgta
gagaaaatggttaatgatgactttgtgccagacgttattgttgctatcttaactggtgga
gtaataccagctaaattagtcgcagacgcattagggattagaaatataaaatacatagat
ataaaattctataaaggaattgagtctagagaaagaaaaccagtaataaaagctgtttat
gtagataacttagaaaataagaaggttctaataatagatgacgtagcagatactggtgaa
acattagatgctgtaggtaacatcataactatgtataatccttctctcattagatcagct
acggtatatgtgaaaccttggtctaggaaatatcctgattattattataaaatattagat
aaatggatcatttttccatgggataaatgggaagtagtaagagaaaacacaaatgcacca
atagataaaaaggaaaaatattttgatattttgagaaaacttagaaaatag

DBGET integrated database retrieval system