KEGG   Sulfurisphaera tokodaii: STK_05540
Entry
STK_05540         CDS       T00062                                 

Definition
(GenBank) methylmalonyl-CoA epimerase
  KO
K05606  methylmalonyl-CoA/ethylmalonyl-CoA epimerase [EC:5.1.99.1]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00280  Valine, leucine and isoleucine degradation
sto00630  Glyoxylate and dicarboxylate metabolism
sto00640  Propanoate metabolism
sto00720  Carbon fixation pathways in prokaryotes
sto01100  Metabolic pathways
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
Module
sto_M00375  Hydroxypropionate-hydroxybutylate cycle
sto_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    STK_05540
   00640 Propanoate metabolism
    STK_05540
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    STK_05540
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STK_05540
Enzymes [BR:sto01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.1  methylmalonyl-CoA epimerase
     STK_05540
SSDB
Motif
Pfam: Glyoxalase_4 Glyoxalase Glyoxalase_3 Glyoxalase_2 Glyoxalase_6 CppA_N Exotox-A_bind
Other DBs
NCBI-ProteinID: BAB65550
UniProt: Q974V7
Position
548048..548470
AA seq 140 aa
METQNIDHIGIAVENIEEAIKFYTEKLGMKVIHREVLEDRGLKVAFLTGKEGETAIELLE
PINHEDMNNTVAKFIKNRGQGLHHLAIKVENIESSLKELESQGIQLVDKKPRPGARGHLV
AFVHPKSVMGVLLELVQPRE
NT seq 423 nt   +upstreamnt  +downstreamnt
atggagacacaaaatatagatcatataggtattgctgtggaaaatatagaggaagcaata
aaattttatactgaaaagttgggaatgaaggttatacatagagaagtgttggaggataga
ggcttaaaggttgcatttttaactggtaaagaaggcgaaacagcaatagaattattagaa
cctattaaccatgaagatatgaataatactgtagctaaattcattaaaaataggggtcag
ggtttacatcatttagctataaaagttgaaaacatagagtcttcacttaaggagttagaa
tctcaaggaattcagttagttgataaaaagccaagacctggtgctagagggcatttagtt
gcgtttgttcaccctaagagtgtgatgggtgttttactggagttagttcagccgagagaa
taa

DBGET integrated database retrieval system