KEGG   Sulfurisphaera tokodaii: STK_05730
Entry
STK_05730         CDS       T00062                                 
Symbol
dbh
Name
(GenBank) DNA polymerase IV
  KO
K04479  DNA polymerase IV (archaeal DinB-like DNA polymerase) [EC:2.7.7.7]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sto03400]
    STK_05730 (dbh)
Enzymes [BR:sto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     STK_05730 (dbh)
DNA repair and recombination proteins [BR:sto03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    STK_05730 (dbh)
SSDB
Motif
Pfam: IMS IMS_HHH IMS_C DUF1805 HHH_5 POLH-Rev1_HhH Cdd1 BAF
Other DBs
NCBI-ProteinID: BAK54334
UniProt: Q974T8
Position
complement(562410..563465)
AA seq 351 aa
MIILFVDFDYFFAQVEEVLNPQYKGKPLIVCVYSGRNEKSGAVATANYEARKLGVKAGMP
ISRAMELAPNAIFVPMHKEVYTEVSNRIMSIISSYSDKIEIASIDEAYIDITSKVKNFEE
AIELGKKLKREIMEKEKITVTVGIAPNKVFAKIIADRVKPNGLGVVKPEEIEEFIKSIDI
DEVPGVGNVISERLHSLGVNKLIDILSVSFDKLKEEIGEAKAFYLYRLATNSYFEPVLNK
ERVPHGRYLTLPKNTRDIKVIELYLKKAIDEAYNKIEGIPKRMTVVTIMQDLDIVSKSKT
FKTGISKERAYTESIELLKQILQKDSRLVRRVGVRFDNIYKSKGLDVFFNS
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgataatattgtttgtggattttgattatttctttgctcaagtagaggaagttttaaat
cctcaatataaaggaaaacctcttatagtctgtgtttattctggtagaaatgagaaaagt
ggagctgtagcgacagctaattatgaagctaggaagttaggagtaaaagctggaatgcct
atatcaagagcaatggaattagcaccaaatgcaatattcgttccaatgcacaaagaagta
tatactgaggtttctaatagaataatgagcataatcagtagctattcggataaaattgaa
atagctagcatagacgaggcctacatcgatataactagcaaggtgaaaaattttgaagag
gcgatagaattaggaaaaaaattaaaacgagaaataatggagaaggaaaagattacagta
acagttggaatcgcaccaaataaggtttttgcaaaaatcattgcagatagagtaaaacca
aatggattaggagtagtaaaaccagaagaaatagaggagttcatcaaaagtattgatata
gatgaggttcctggtgtaggtaatgttatttctgaaagacttcattcattaggtgtaaat
aagttgatagatattttatctgtttcatttgataaattaaaagaagagataggggaagct
aaggcattttatctttatagattagccacaaactcttattttgagccggtattaaataaa
gaaagggtaccgcatggaagatatttgacattacctaaaaatactagagatataaaagtg
atagaactttatctgaaaaaagctatagatgaagcatacaacaaaatagaaggtatacct
aagagaatgactgtggtaactatcatgcaggacttagacatcgtaagtaaaagtaaaact
tttaaaactggtataagtaaagagagagcttatacagaatcaattgaattattaaaacaa
attttacaaaaagatagtagattagttagaagagttggagtaagatttgataatatatac
aaatcgaagggattagacgttttcttcaatagttaa

DBGET integrated database retrieval system