KEGG   Sulfurisphaera tokodaii: STK_05740
Entry
STK_05740         CDS       T00062                                 

Definition
(GenBank) putative sugar kinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00030  Pentose phosphate pathway
sto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STK_05740
Enzymes [BR:sto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     STK_05740
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: BAB65570
UniProt: Q974T7
Position
complement(563462..564319)
AA seq 285 aa
MKPIHLSVGRFNIDIIVNIEKMPDTDEFLTTDLMEIMPGGAAVNYAVAITKLGHSSKLLA
KVGKNTITQSLMESIAEMGVGLDYVEETNAPQSMALIFLRKNGKISMVRKLGASTLITQE
DVKKYFGLFDTIHFASVPPNIVVRDPMARLISYDPGPFSKDVNEVDVDVLYLNEKESKAI
NLDKIRAKIIVIKMGEKGAKVITENQECYVEAYKVDNIVDTTGAGDVFDATFNYSLLEGL
SIEEGLKLAVTASAIKIQRLGGISSPNLNEVHEALKIYEPKVKCI
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaaacctatacatttatcagtgggtagatttaatatagatattattgtaaatatagaa
aaaatgcctgatacagacgagtttctaactactgatttaatggaaattatgccaggtggt
gctgcagtaaattatgctgtagctataacaaagttagggcatagtagcaagttattagca
aaagtagggaaaaacactataactcagagtctaatggagagtatagctgaaatgggtgta
ggacttgattatgtagaagagactaatgctccacaaagtatggcattaatattcttaaga
aagaatggcaagatttctatggtaagaaaacttggtgcttcaacattaattacccaagaa
gacgtgaaaaagtattttggacttttcgatactatccattttgcctcagttcctccaaac
atagttgtgagagatccgatggcaagattaatctcttatgaccctggccccttcagtaaa
gatgttaatgaagtagatgttgatgtactttacctaaatgagaaagaaagtaaggcaatt
aatttagataagattagagctaaaatcattgtaattaaaatgggagaaaaaggagcgaaa
gtaattactgaaaatcaagagtgctatgttgaagcatacaaagtagacaatattgtagat
acgactggtgcaggagatgtttttgacgctacgttcaattactctcttttagaaggatta
agtattgaagaaggattaaaattagctgtgaccgcatctgcaattaagatacaaaggctt
ggcggaataagctcaccaaatcttaatgaagtgcatgaagcactaaaaatctatgagcct
aaggtaaaatgtatatga

DBGET integrated database retrieval system