KEGG   Sulfurisphaera tokodaii: STK_05840
Entry
STK_05840         CDS       T00062                                 
Symbol
bcp
Name
(GenBank) peroxiredoxin
  KO
K03386  peroxiredoxin 2/4 [EC:1.11.1.24]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sto04147]
    STK_05840 (bcp)
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     STK_05840 (bcp)
Exosome [BR:sto04147]
 Exosomal proteins
  Proteins found in most exosomes
   STK_05840 (bcp)
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C AhpC-TSA_2
Other DBs
NCBI-ProteinID: BAK54339
UniProt: Q974S8
Position
570524..571171
AA seq 215 aa
MVKLYSKFPDVQVLTTKGPIDFYKDIFGKGKWLFLFAHPADFTPVCTTEFVAFSQKYEEF
KKLGVELVGLSVDSIYSHIQWLMDIEQRYGVKVPFPVIADPDKKLARMLDALDEASGQTI
RIVVLASPDGIIRFVAQYPMEFGRNIDELLRITKAAIVNYKAKVVLPANWQPGQDVIVPP
PAIFDEAEMRIKLPNAKAWYLLFKKYEELPPDQKV
NT seq 648 nt   +upstreamnt  +downstreamnt
atggtcaaactatactctaagttcccagatgttcaagtattaacaacaaaaggtccaatt
gatttctacaaagatatatttggtaaaggaaaatggttattcctattcgctcatccagca
gactttacaccagtatgtacaacagaatttgtagcattctcgcaaaagtatgaggaattc
aaaaaacttggtgtagaacttgttggactaagtgttgatagtatttactctcatatacaa
tggttaatggatattgaacagagatacggcgtaaaagtaccattcccagtaatagcagac
ccagacaagaaattagcaaggatgttagatgcattagatgaggcctccggtcaaactata
agaattgttgttctagcatcaccggatggaataatcagatttgttgctcaatatccaatg
gagtttggaagaaatattgacgaattgttaagaataactaaagctgcaatagttaactat
aaagcaaaagtagtacttccagcaaattggcaacctggtcaagacgttatagtaccgcca
ccagccatatttgatgaagcagaaatgagaatcaaattaccaaatgcaaaagcatggtac
ttattattcaagaaatatgaagaacttccaccagatcagaaagtctga

DBGET integrated database retrieval system