KEGG   Sulfurisphaera tokodaii: STK_06300
Entry
STK_06300         CDS       T00062                                 
Name
(GenBank) hypothetical protein
  KO
K21947  tRNA-5-methyluridine54 2-sulfurtransferase [EC:2.8.1.15]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sto03016]
    STK_06300
Enzymes [BR:sto01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.15  tRNA-5-methyluridine54 2-sulfurtransferase
     STK_06300
Transfer RNA biogenesis [BR:sto03016]
 Prokaryotic type
  tRNA modification factors
   Thiolation factors
    STK_06300
SSDB
Motif
Pfam: ATP_bind_3 tRNA_Me_trans PAPS_reduct NAD_synthase QueC Arginosuc_synth DZR_2 Usp ThiI Asn_synthase zinc_ribbon_15 zf-RRN7
Other DBs
NCBI-ProteinID: BAB65628
UniProt: Q974M9
Position
complement(615629..616585)
AA seq 318 aa
MKCSKCNNKAIIKIPYSNLALCKDHFIEWFERRFERIVDKYKMFENSKKIAVAVSGGKDS
TTLLHLMKKLSEKKGFEIIGINIDLGIDMGKQYSSKSTEFALKNFEMLGVKYRIVRIKER
YGFTIDDAKHKIKRPVCSTCGLVKRYTLTEIAEEEGADTIVTGHNLNDMAQFIMAGYFNG
DVRDLARLDIITPPEKGYKVTKVKPLFLIYEKEILTYALVKGIPFLYDSCPHTFRVGGAT
QDTIRRKLEELEEAIPGYMLMLVENFINKIQPALKEKYIKEEEIGHCKICGRPTTKDREI
CSFCAVRLKMTGQTINIK
NT seq 957 nt   +upstreamnt  +downstreamnt
atgaaatgcagtaagtgtaataataaggctattataaaaatcccttattctaatctggca
ttatgtaaagatcactttattgagtggtttgaaagaagatttgagaggatagttgataag
tataagatgtttgaaaactcaaagaaaatagctgtagcagtttctgggggaaaagatagt
acgactttgcttcatttaatgaagaagctgagtgaaaagaaggggtttgaaataatcggt
ataaacattgatttaggtatagatatgggtaaacaatattcctcaaagagtacagagttt
gctttaaagaatttcgaaatgttaggtgttaaatacagaattgtaaggataaaagagagg
tatgggtttacaattgatgacgcaaagcataagataaaaagacccgtatgcagtacttgt
ggattagtaaaaaggtatactctaacagaaattgcagaagaagaaggagcagatacgata
gtgactggccataatttaaatgatatggcacaatttataatggctggatattttaatggt
gatgtaagagatttagcaagactagatatcataactccaccagaaaagggatataaagta
acgaaagttaaaccactcttcctaatttatgagaaagaaattttaacttatgccttagta
aaaggaattccgttcctatatgattcatgccctcatacattcagagttggtggtgctact
caagataccataaggagaaaattagaagagctcgaagaggcaataccaggttatatgtta
atgttagtagagaatttcataaataaaattcaaccagctttaaaggagaagtatataaaa
gaggaagaaataggccattgtaagatttgcggtaggcccacaactaaggatagagaaatc
tgctcattttgtgcagtaaggttaaaaatgactggacagacaattaatataaaatga

DBGET integrated database retrieval system