KEGG   Sulfurisphaera tokodaii: STK_06390
Entry
STK_06390         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Molybdopterin Molydop_binding SCO1-SenC
Other DBs
NCBI-ProteinID: BAB65637
UniProt: Q974M0
Position
623442..625193
AA seq 583 aa
MIACTRDCYDTCIFDSNYKPLNIFPINGFTCSRGIADLKRNEINRVDSAYIEGKPVSIDE
AVKYIVKKIKETKREEILHIDYDGNQGLLTWYYPARFWNAIGSSSTDYSICSAEGHEAIK
IHYGTSFGALPEDFVRYNAVVFWGSEAVFSFIHGWRILSNKYKITIDVRMSETAKRSEKA
YIINPASDAFLAIGVIKTLFYEGLYDPSMIDNVEILKNYVNSYDFSLIEETTGLSQEEIE
ELAELYYYYKPLTIIGFALGRTYNGGDAISLISLIPALLGMKRGFFYSNSQGWGIDFSYL
RGLHIAKPSRIIGMAEVGKEVEKGNVKFLFTWNSNPIHSLPGSDKIKEAVEEGKLFLVSH
DPFWNETTKIANVVIPAPTFLEKYDVVYSYWHSYLVYNEPIRPQRGITEVELMKKLAKEY
GIISHPLIEENEWIAVDNAIRGTGVSLQELKDKKIVKMNKTIEVNKVKVEPLPKLTPPPK
GVYLVFSSHPNHTNSQFKEIYSQMPIAYNNQLDGIGYLENSNGKVKVLLKKDESVPNNVV
FMFKSSLIGLDDKPINSLIGSEKGKYGGTPLLNGHTVNIRLIK
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgattgcatgtacaagggactgttatgatacttgtatatttgattctaattataaacct
ttgaacattttccctataaacggatttacttgttctagaggaattgcagatttaaaaaga
aatgagattaacagagtggactccgcttacatagagggtaagcctgtttctatagatgaa
gccgtaaagtatatagtaaaaaagataaaagaaactaaaagagaagaaattcttcatatt
gactatgacggcaatcaaggactattaacatggtactatcctgcaagattttggaatgca
attggttcatcatctactgactattcaatttgctctgctgaagggcacgaagctattaag
attcactacggtacttcttttggtgcgttaccagaagattttgttagatataacgctgta
gtcttttggggatcagaagccgttttctcttttattcatggatggagaattctatctaat
aaatacaagataacaattgatgtaagaatgagtgaaaccgcaaaaagaagtgaaaaagcc
tatatcataaacccagcttcagatgcgtttttagcaattggtgttattaaaacgttattt
tatgaaggtctttatgatccttcaatgattgataacgtcgaaattctaaagaattatgta
aattcttatgatttctcgttgatagaagagactactggtttatctcaggaggaaattgaa
gagttagctgaactttattactattataaacccttaacaataattggtttcgctttagga
agaacatataatggcggtgatgctatctcattaatttctttgattcccgctttattgggc
atgaaaagaggattcttttactcaaacagtcaaggatggggaatagacttctcctatctt
cgcgggttgcatatagcaaaaccaagcagaattataggtatggctgaagtagggaaagaa
gttgaaaaaggaaatgtaaagtttctattcacttggaactctaatcctattcattctttg
ccaggaagtgataaaataaaagaagctgtcgaagaaggaaagttgtttttagtttctcat
gatcccttttggaatgagaccacaaaaatagcaaatgttgttattccagcaccaactttt
ttagaaaagtatgatgtagtatatagttattggcacagctatctagtctataacgaacct
attagaccacaaagagggattactgaagttgaattgatgaaaaagcttgcaaaagaatat
gggattatttctcatcctctcattgaggaaaacgaatggattgctgtagataacgcaata
agaggtactggagtttctttacaagaattaaaagacaagaagatagttaaaatgaataag
actattgaagttaacaaagttaaagttgagcctctacccaaactaactcctcctcctaag
ggagtttacttggtcttctcttcacatcctaaccatacaaattctcaatttaaggaaata
tactctcagatgcctatagcatataataatcaacttgatggtataggttatctagaaaat
tccaatgggaaagttaaagtacttctgaaaaaggatgagagcgtacccaacaatgtagtt
ttcatgtttaagagttccttaattggattagatgacaagccaatcaactcgcttattggt
agtgaaaaaggaaaatatggaggaactccattacttaacgggcatactgttaatattaga
ttaataaaataa

DBGET integrated database retrieval system