KEGG   Sulfurisphaera tokodaii: STK_06400
Entry
STK_06400         CDS       T00062                                 
Name
(GenBank) putative peptidase M61 family protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Peptidase_M61 Peptidase_M61_N PDZ_6 PDZ_2 PDZ
Other DBs
NCBI-ProteinID: BAB65639
UniProt: Q974L9
Position
complement(625484..626992)
AA seq 502 aa
MRFIVTPRNRYIEVEGEGREGIITFPTWVPGSYFIREQERNVIFYDYGYQISKNKFWING
KFKYIYYANSKDQREVISLSDYLFINPVSLFPFQDLNEKYCVKINVKWPIHTTLRKEGEW
YCGDNYDEFADSPIQASPHLKLIEIDEKHSISTIDDFTEVEKLRNVIRVIDSYLPDSLPN
YIFFFRRSDKNLGGIEHKDSSAIVTTWDRKDLLWLFAHEYFHRWNIKRIKPKDLKIDYEH
ENYTELLWVAEGLTDYMAFLSLIESGVINANDALKAVANILQNLTFLGFKRMSIAESSKL
TWIKLYKRDENYPNIGISYYDAGFILGLLMDFAIRENNECKKSIVDFFRELYKVGEYTYA
DVKEIAESLGFKNLDELVYKRNPPILEYLGRYMKIIFTDKDKPYYGIRVENNVITFIEDN
SPADLAGLNIGDEIIAVDGIKKQIEVKEEVLLTISREGRLKEIKLRAGNNPGHRIRLIGE
GKLFKCIFGEEKAEGESEQKIV
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgagatttattgtaacaccaagaaatagatatattgaagttgaaggagaaggtagagaa
gggataataacttttcctacatgggttcctggctcatattttataagggaacaagaaaga
aacgtgatattttatgattatggctatcaaatttctaaaaataaattttggataaatgga
aaattcaaatacatttattacgcgaactcaaaggatcaaagagaggttatttcactgtca
gattatcttttcataaatccggtgtccttattcccatttcaagatctaaatgaaaagtat
tgtgtaaaaattaatgttaagtggcctattcatactactttaagaaaagaaggtgaatgg
tattgtggagataactatgacgaattcgctgactcacctatccaagcatcaccacatcta
aaactgattgagattgacgaaaagcactcaatttcaactatagatgatttcacagaagta
gaaaagcttagaaatgttatacgtgtgatagattcttatctcccagattctttgccaaat
tatattttcttctttagaagaagtgataaaaacctagggggaatagagcataaagattct
tctgcaatagttactacttgggatagaaaagatcttttatggttatttgctcatgagtac
tttcacagatggaatataaagagaattaaaccgaaggatttaaagatcgactacgaacat
gaaaattatactgagctactctgggttgctgaaggtttaactgactacatggcattctta
tctctaatagaaagtggagttataaatgcaaatgatgcactgaaagctgtcgcaaatatt
cttcaaaatctcactttcctaggatttaagagaatgagtattgcagaatcatctaagtta
acttggattaaactctataaaagagacgaaaattatcctaatattggcatttcctattac
gatgcaggatttattttaggacttttaatggacttcgctataagggagaataatgagtgt
aaaaagagcatagtagattttttcagagagctgtataaggtaggggaatatacttacgct
gatgtaaaagaaattgctgagagcttagggtttaaaaacctagatgaattagtatacaag
aggaatccgccaattttagaatatctaggccgttatatgaaaataatatttaccgataaa
gataaaccctactatggtataagggttgagaataacgttattacgtttattgaagataat
tctccagctgacttagctggattaaatataggagacgaaataatagccgtggacggaatt
aaaaagcaaatagaagttaaggaagaagttcttcttactatatctagagagggaagatta
aaggagattaagctaagggctgggaataaccctggacataggatacggcttattggagaa
ggaaaattgtttaaatgtatttttggggaagaaaaagcagaaggggaaagtgaacaaaaa
atagtttag

DBGET integrated database retrieval system