KEGG   Sulfurisphaera tokodaii: STK_06460
Entry
STK_06460         CDS       T00062                                 
Symbol
proC
Name
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00330  Arginine and proline metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    STK_06460 (proC)
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     STK_06460 (proC)
SSDB
Motif
Pfam: P5CR_dimer F420_oxidored 2-Hacid_dh_C NAD_Gly3P_dh_N NAD_binding_2 PDH_N ApbA IlvN DapB_N ADH_zinc_N Shikimate_DH UDPG_MGDP_dh_N Phage_holin_2_1 TrkA_N CoA_binding_2 Rossmann-like GFO_IDH_MocA Sacchrp_dh_NADP UDPG_MGDP_dh_C
Other DBs
NCBI-ProteinID: BAB65645
UniProt: Q974L3
Position
631908..632687
AA seq 259 aa
MRVSIIGVGKIGYAILKGLKSLNVEIIGTGRSEETLDKIKKEGVEATRDNEYAIKKSDII
ILAVKPQHFHSILDKVSKTAWEGKKVVSVMAGIRISTLTRLTNAKVYRAMPNINAVIGKA
TTALAEERDEEVERIFRTIGNVYWIPEELFDAWTAIIGSGPAFVAEIIDAFALGAVACGM
SRELAYQAILDMVEGTVYTLRKDKTHPVLLRDQVTTPAGTTIRGLMVMESEGIKSAIIKT
IEAAYQRSMAIGKEIDKMY
NT seq 780 nt   +upstreamnt  +downstreamnt
atgagagtaagtataataggagtaggtaagataggttatgctattttaaaaggactaaaa
agccttaatgttgaaatcataggtactggaagaagtgaagagaccttagataaaattaaa
aaagaaggcgtagaggctactagagacaatgagtatgctataaaaaagagtgatataatt
atattggctgtaaaacctcaacatttccattccatcttagacaaggtgagtaaaactgca
tgggagggtaaaaaagttgtttcagttatggctggtataaggatttctacgttaactagg
ctgacgaatgctaaagtatatagggcaatgcctaacataaatgcggtcattggtaaggct
acaacagcattagctgaagaaagagatgaggaagttgaaagaatttttaggactattgga
aacgtttactggattccagaggaattgtttgatgcatggacagcaataattggtagtggt
ccagcgtttgttgcagagataatagatgctttcgcactaggtgctgtagcatgtggaatg
tcaagagaacttgcctatcaggcaatattagatatggtagaaggtaccgtatatacttta
agaaaggataaaactcatccggttctattgagagatcaggtaactactcctgccggtacc
actattagggggttaatggttatggaaagtgagggaataaaatcagctattattaagact
attgaggctgcatatcaaaggtcaatggcaataggtaaggagatcgataaaatgtattaa

DBGET integrated database retrieval system