KEGG   Sulfurisphaera tokodaii: STK_06480
Entry
STK_06480         CDS       T00062                                 
Name
(GenBank) nicotinamide-mononucleotide adenylyltransferase
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00760  Nicotinate and nicotinamide metabolism
sto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    STK_06480
Enzymes [BR:sto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     STK_06480
SSDB
Motif
Pfam: CTP_transf_like HIGH_NTase1 Citrate_ly_lig LigB
Other DBs
NCBI-ProteinID: BAK54361
UniProt: Q974L1
Position
complement(633028..633546)
AA seq 172 aa
MRAVFPGRFQPFHLGHLAVIEWLLSKYDELIIVVGSGKDSHTIYNPFTAGERILMIKKGL
KEFNVDFTRVIFFPIMDSFTSGLWIRNLELYSPKFDVVVSGNPLVISDAREAGYIVDLPP
MFNREMYNATKIRKLMLENNESWSELVPKSVYSFIKEIKGDERLRDIARNDY
NT seq 519 nt   +upstreamnt  +downstreamnt
atgagagctgtatttccgggacgatttcagccattccacttaggtcatttagctgtaata
gagtggttactcagcaaatatgacgaactaattatagttgtaggaagcgggaaagatagt
catactatatataacccttttacagcaggagaaaggatccttatgattaaaaaaggactc
aaagaatttaacgtagatttcactagagttatattctttccaataatggattcatttact
agtggattatggattagaaatttagaactatattcacccaaatttgatgtagtagtaagc
ggaaatcctctagttatatctgatgctagagaagctggatatatagtagatctacctcca
atgtttaacagggaaatgtataatgctactaaaataagaaagctaatgttggaaaataat
gaaagttggagcgaactagttcctaaaagtgtttacagttttataaaagagattaagggg
gacgaaagattaagagatattgctaggaacgattactga

DBGET integrated database retrieval system