KEGG   Sulfurisphaera tokodaii: STK_06710
Entry
STK_06710         CDS       T00062                                 
Name
(GenBank) putative transposase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: HTH_23 Zn_Tnp_IS1 HTH_28 Sigma70_r4_2 Terminase_5 HTH_38 HTH_Tnp_1 zf-ribbon_3 HTH_Tnp_ISL3 HTH_Tnp_IS630 HTH_29 DUF1804 HTH_40 Zn_Tnp_IS1595 GerE HTH_Tnp_IS1 OrfB_Zn_ribbon
Other DBs
NCBI-ProteinID: BAB65671
UniProt: Q974I7
Position
654300..655097
AA seq 265 aa
MSSLGDSVVIKLFIFVLRVLLMGRKPVFRQDLACPSCGSHHVVKCGKPLGRQRFLCRDCG
KYFLADAIYHHHSKEVREKALRMYTNGMSMRAISRVLNVPLGTVFTWIKRYGKRKYEKLV
DLWNKAKELVKGKVVTKVVDEMWTYLYRNTRAFYKWVFTCYVYTRLGLYIIYSVGDRDEN
TFREVKDYVPDDGRWVSDDYNVYFWLKNHTVVSLVNPNEGLHSSLRDRLVRFKRATKAVN
RSINMVKYSIALVLWERRLIPEFVA
NT seq 798 nt   +upstreamnt  +downstreamnt
gtgtcgtcattaggggatagtgtcgtcattaagctatttatatttgtattacgagtatta
cttatgggtaggaagcctgtatttaggcaagatttagcttgtccctcttgtggtagtcat
cacgtcgttaagtgcggtaagcctcttggtaggcagaggtttctgtgtagggattgcggt
aagtacttccttgcagacgcaatttatcaccaccactctaaggaggtgagggagaaggct
ttgaggatgtatactaatggtatgagtatgagagctatttctagggttcttaacgtacct
ctgggtactgttttcacttggattaagcgttatggtaagaggaaatatgagaagctagtg
gacttgtggaataaggctaaagagctggtcaagggtaaggtcgttactaaggttgttgat
gagatgtggacatacttgtacagaaacactagggctttctacaagtgggtattcacttgt
tatgtgtacactaggctagggttatacataatttactctgtgggtgatagggacgagaat
acttttcgtgaggtcaaggactacgtgccagatgatggtaggtgggtgagtgatgattac
aacgtttacttttggttaaaaaaccacacggtagtctcacttgttaatcccaacgagggg
cttcattcctcactgagggataggcttgtacgtttcaagagggctacgaaggctgttaac
aggagtataaatatggtgaagtattctatagcactagtcttgtgggagagaaggctaatc
ccagaatttgtagcttaa

DBGET integrated database retrieval system