KEGG   Sulfurisphaera tokodaii: STK_06940
Entry
STK_06940         CDS       T00062                                 
Name
(GenBank) putative 2-hydroxyacid dehydrogenase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh AdoHcyase_NAD ThiF PglD_N Shikimate_DH
Other DBs
NCBI-ProteinID: BAB65700
UniProt: Q974F8
Position
complement(678064..678957)
AA seq 297 aa
MIISTVKLPEECKRLIPVKDEGITEDDIRNAEIIMLWPSQAREILPKAEKVKIIQTFSAG
VDDFPFELLKKDQLLYSNAGAYSISVAEHAFALILALAKGVGVKKRVETYPLNNSTILIL
GAGGIGSEVAKIAKLGFNMYVIGVSRSFKGTYYDEKYSLKDLEKVIGRADVIVDTLPLNK
ETRGILNYSVLSKVKEKCIIVNVGRAETVIEDDIYRILKEKPGVRFGTDVFWRVNGKENF
STSKLWELENFTGTPHIAGATANERVLKNALIQACKNVYRILNEGEGENKVKIEDYI
NT seq 894 nt   +upstreamnt  +downstreamnt
atgattatttctacagtcaaattacccgaggaatgtaagagattaatcccagtaaaagat
gaaggtattacagaagatgatataagaaatgctgaaattataatgctttggccatctcaa
gctagagaaattttacctaaagctgaaaaagtaaaaataattcaaactttttcagcagga
gtcgatgattttccttttgaactattaaagaaagatcaattactgtattcaaatgcgggg
gcttattctatatcagttgctgagcacgcttttgcacttattttagcattagctaagggt
gttggagtgaagaaaagagttgaaacgtatcccttgaataattctacaatactaattcta
ggtgctggtggtataggatctgaagtagcaaaaatagcaaagctaggttttaatatgtat
gtcattggtgtatcaagatcatttaaaggaacttattatgatgaaaaatattcactgaag
gatcttgaaaaagttataggaagggcagatgttatagttgatacgcttccattaaataaa
gagactagaggtatactaaattactctgttttatcaaaagttaaggaaaaatgtataatt
gtaaatgtaggtagagctgagactgtcatagaagatgatatatataggattttgaaggaa
aaacctggagtaaggtttggtactgatgttttttggagagtcaatggaaaggagaatttt
tctacctctaaactgtgggagttagagaatttcactggaacacctcacatagctggagct
acggcaaatgaaagggtattaaagaatgcacttatacaagcatgcaaaaatgtttacaga
atacttaatgaaggagaaggagaaaataaagtgaaaattgaggattacatctag

DBGET integrated database retrieval system