KEGG   Sulfurisphaera tokodaii: STK_07240
Entry
STK_07240         CDS       T00062                                 
Name
(GenBank) putative 3,4-dihydroxyphenylacetate-2,3-dioxygenase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_7
Other DBs
NCBI-ProteinID: BAB65732
UniProt: Q974C8
Position
708802..709752
AA seq 316 aa
MIDILRLSHVGIRVTDLEKARYFYVDLLGFVETEKDGDYIYLRGIDEGQHHSLVLKKADS
PGLSYIGFRVRRAEELDKAKEELQKLNLKFTRFKEKGVEEAILFETPQGMPFLIYYDMEY
VGDMRMKFYAHRGVSPVRLAHVNYVVKDIEEEVQFLKNFMGYYETEWFLGKDNQTREVIW
LTRRGDSHEIAIAKSQKNVPGFHHETYYVHELKDVIRAADIVASAELWDSIERGPGRHGV
TEGYYVYLRDFDKNRIEFFTEDYVVLDPDKWKPVVWRNEQFRYRSDFWGRPIPQSWLSEW
VPVEDISTGKLKGWSI
NT seq 951 nt   +upstreamnt  +downstreamnt
atgattgatatcctacgtttatctcatgtgggaataagagttactgatctagagaaagca
agatatttttacgtagatttactaggatttgtggaaacagaaaaggatggtgactacata
tatttaaggggtatcgatgagggacagcaccacagcttagttcttaaaaaggctgactct
cccggtttgtcatatattggatttagagtaagaagagctgaggagctcgataaggctaaa
gaagagctacaaaagcttaacctaaaatttaccaggtttaaggagaaaggtgttgaggaa
gccatactctttgagactcctcaaggtatgccgtttctaatctattacgatatggagtat
gttggagatatgagaatgaagttttatgcacatagaggtgtttcaccagtaaggttagct
catgtaaattatgtggtaaaggatattgaggaagaagttcaattccttaaaaactttatg
ggctattatgaaactgaatggttcttaggaaaagataatcaaaccagagaagtaatttgg
cttacaagaaggggagattcacacgagattgcaattgctaaaagtcaaaaaaatgttcca
ggatttcatcacgagacttactacgttcatgagctaaaagatgtaatcagagcagctgat
attgtagcttcagcagaattatgggatagtattgagaggggtccgggtagacatggagtt
acggagggttattatgtttatcttagagattttgataaaaataggattgagttctttaca
gaggattacgtagttttagacccagataaatggaaaccagtagtatggagaaatgaacag
tttagatatagaagtgatttttggggaagaccaattccccaatcttggttaagtgaatgg
gttcccgtggaggatatttccacgggtaaattaaaggggtggtctatttga

DBGET integrated database retrieval system