KEGG   Sulfurisphaera tokodaii: STK_07280
Entry
STK_07280         CDS       T00062                                 

Definition
(GenBank) putative Na(+)/H(+) antiporter
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Na_H_Exchanger
Other DBs
NCBI-ProteinID: BAB65736
UniProt: Q974C4
Position
complement(712082..713242)
AA seq 386 aa
MEEIYIALFDIALFIFIAEFFKTQLRKIDLPDLVSELIAGMIIGPYAVGGLINDILGFHL
ITLDQYVLFISEFAVILIIFASGLEHGLSPLKEAGILGFMGATFGALLPFFAGYFIYANS
FGSNSALFLGVSLGATSLAAVAYLIEGINTKGVKFLISASAVDDIVDLILLSTVLILIKN
STIVITSISLRIVSLIVIWLVILFLSITIIPRIANKLSDVYIEEFTMLVLFGLTLFMVYL
GYSPIISAFVAGVSISNSLKSEKIKEIVTIVLSVFGPMFFVTVGAEVNLLLINLNTLLLA
LELTSIATIFKMLGIMPFAYLYIKDLKRAMIIALGMVPRGETGLVVASIGLSLNALDQNE
FESIVFMSILTTVIGALVIKRYSHQL
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggaagaaatttatatagctctttttgatatagctctttttatttttattgctgaattt
tttaagacacagctaagaaaaattgatttgccagacctggtaagcgaacttattgctggt
atgatcataggaccttatgcagttggtgggctgataaatgatattttgggttttcatcta
ataactctagatcaatacgtcctttttatatctgaatttgctgtaattcttattatcttt
gcttctggtttagaacatggtctaagtccgcttaaagaagccggaatattaggatttatg
ggagccactttcggtgcattattaccattttttgccggatattttatatatgctaactct
ttcggaagcaattcggcattatttttgggagtaagcttaggtgctacaagtttagctgct
gtagcatatctaatagaggggattaatactaagggtgttaagtttttaatttctgcgtca
gccgtagatgatatagtagatttaatcttattatctacagtacttattcttattaaaaac
tccactatagttataacgtctatatctttaagaatagtgtcactaattgtaatttggtta
gtaattttatttctttccataacgattatcccaaggatagctaacaagttgagtgatgtt
tatatagaagaattcacaatgctcgtattatttggattaacattatttatggtttattta
ggatattccccaattatatctgcctttgtagctggtgtatcaatctctaattccttgaag
agtgaaaaaattaaggaaattgttactatagtactctcagtatttggtccgatgttcttt
gtaactgttggagcggaagtaaatttgcttttaattaatttaaacactttattacttgcg
ctggagctcacgagtatagcaactatttttaaaatgctcggaattatgccatttgcttat
ctatatattaaagatcttaaaagggcaatgattattgccctaggaatggtccctagagga
gaaactggcttagtagtagcatcaataggtttaagtctaaacgctttagatcaaaatgag
tttgagagtatagttttcatgtcaattctgactacagtaataggtgctctagttattaaa
cgttattctcatcaattatag

DBGET integrated database retrieval system