KEGG   Sulfurisphaera tokodaii: STK_07300
Entry
STK_07300         CDS       T00062                                 
Name
(GenBank) acyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00010  Glycolysis / Gluconeogenesis
sto00620  Pyruvate metabolism
sto00630  Glyoxylate and dicarboxylate metabolism
sto00640  Propanoate metabolism
sto00680  Methane metabolism
sto00720  Carbon fixation pathways in prokaryotes
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STK_07300
   00620 Pyruvate metabolism
    STK_07300
   00630 Glyoxylate and dicarboxylate metabolism
    STK_07300
   00640 Propanoate metabolism
    STK_07300
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    STK_07300
   00680 Methane metabolism
    STK_07300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sto01004]
    STK_07300
Enzymes [BR:sto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     STK_07300
Lipid biosynthesis proteins [BR:sto01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   STK_07300
SSDB
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Other DBs
NCBI-ProteinID: BAB65737
UniProt: Q974C3
Position
complement(713274..715262)
AA seq 662 aa
MSVNWALPFNTKIVPKSNKVVDINTYKEIHSTSLRDYKGFWASVASELDWFKPWEKVLDD
SNPPFYKWFVGGEINASYLAVDRHAKSWRKNKVAIIWEGEPVDENGNPKEVRKLTYYDLY
TEVNRVAYILRNKYGLKKGDAVAIYLPMIPELPIFMLALARIGVVFTVVFSGFSADALAT
RIDDAQAKVLITADGGWRRGKIVPLKDIADKALEKVSTVKDVIVVRRTGQKVNMVEGRDK
YLDDVLREVPQGVYVEPERIKSEDPLYILYTSGTTGKPKGIVHDTGGYLTLLHATMKWVF
DVRDDDIYWCTADIGWVTGHSYIVFGPLMEGVTEIMYEGALDYPKPDRWVSIIERYGVTI
FYTSPTAIRSFMKYGDEWVKAHKTDTIRIIHSVGEPINPEAFEWLWKLIGRGEVPFGSTW
WMTETGGIMISHLPGLYLIPLKPGTNGMPLPGIEADVVDDNGNPTKPEERGYLVIKNPWP
GMPLTIHRDPERYIKIYWSKFPGMFYAGDYAVKDSDGYFWVLGRADEVIKVAGHRLGTYE
LESAIIEHPAVAEAAVVGVPDPVKGEVPVAFVILKQGVSPSKNLMDDILKTVRDKVGPIA
TLSSIYFVSKLPKTRSGKIMRRVVKAVITNQPVGDITTLENEASVEEVKKAYEEFKAEIG
KS
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgtcagtaaattgggcactaccatttaatactaaaattgtacctaagtcaaataaggta
gttgacataaatacttacaaggaaatacatagcacgagtctgagagactataagggattt
tgggcttctgttgcatcagaattagactggtttaagccttgggaaaaggtacttgatgat
tctaatcctccattttataagtggtttgttggtggtgaaataaatgcttcatatttagct
gtggataggcatgctaagagttggagaaaaaataaggtagcaataatttgggaaggagaa
ccagtagatgaaaatggaaaccctaaggaagtgagaaaattaacatattacgatttatac
acagaggttaatagggtagcttacatacttagaaataaatacggtttaaagaaaggagat
gcagtagctatttatctaccaatgataccagaattgccgatatttatgttagcattggct
agaattggagttgtgtttactgtagtattttccggctttagtgctgatgcactagctacg
agaatagatgatgcacaagctaaagtgttaattacagctgatgggggctggagaagaggt
aagatagtaccgttaaaggatattgctgataaagctttagagaaagtttctacggtgaaa
gacgttatagttgttagaagaacaggacaaaaggtaaacatggtcgagggaagagataaa
tatctagatgatgtgttaagggaagttcctcaaggtgtttatgttgaaccagaaaggata
aagagtgaagaccccttatatatactctacacttctggaacaactggtaagccaaaagga
atcgttcacgatactggaggataccttacattacttcatgcgacgatgaaatgggtgttt
gatgttagagatgatgatatttactggtgcactgcagacataggatgggttaccgggcat
tcttatattgtgtttggaccattaatggaaggagttaccgaaataatgtatgaaggagct
ttagactatcctaaaccggatagatgggtttcaataattgaaagatacggcgttacgata
ttctatacatcaccaaccgcaataagatcattcatgaaatacggtgatgaatgggttaag
gcacataagacagacaccatcagaattatacattctgtaggagaaccaataaatccagaa
gcttttgagtggttatggaagttaattggaagaggagaagtaccatttggtagtacttgg
tggatgactgagactggtggtatcatgattagtcacttacccggtctttatttaattcct
ttgaaacctgggactaacggaatgcctttacccggaatagaggcggatgttgttgatgat
aatggtaatcctacaaagcctgaagaaagaggatatctagtaataaagaatccatggcct
ggaatgccattaacaatacatagggatccggagaggtatattaaaatatattggtctaaa
ttcccgggaatgttctatgctggagattatgcagttaaagactctgatggatacttctgg
gtattaggtagggctgatgaggtaattaaagtagctggacatagattaggaacatatgag
ttagagtctgcgattattgaacatccagccgttgctgaagcggcagttgtaggagttcca
gatccggtgaaaggtgaagtaccagtggcatttgttattcttaagcaaggtgtttcgcca
agtaaaaatcttatggatgatatactgaagactgttagagataaggttggtcctattgct
acattatccagtatttactttgtatctaaacttccaaaaactaggagtggtaagattatg
agaagagtagttaaggctgttattactaatcaaccggtaggtgatattacaacgcttgaa
aatgaggcttcagtagaagaagttaagaaggcttatgaggagtttaaggctgagataggt
aaaagttaa

DBGET integrated database retrieval system