KEGG   Sulfurisphaera tokodaii: STK_07490
Entry
STK_07490         CDS       T00062                                 
Name
(GenBank) putative TrmB family transcriptional regulator
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: TrmB MarR_2 MarR TFIIE_alpha HTH_11 HTH_27 HTH_24 GntR HTH_DeoR Penicillinase_R Fe_dep_repress HTH_5 HTH_IclR HTH_34 HTH_36 HTH_Mga HTH_Crp_2 HTH_20 Mga Rrf2 CvfB_WH DUF4423 HTH_29 KORA HxlR RPA_C Dimerisation2 GerE HTH_41 FeoC HTH_PafC Mnd1 HTH_23 B-block_TFIIIC HTH_9 HTH_47 HTH_AsnC-type
Other DBs
NCBI-ProteinID: BAB65758
UniProt: Q974A2
Position
complement(729828..730199)
AA seq 123 aa
MSERLKFPDGREVDIHEVLSFLYGLGGSEIQVLHLLLTEGKMRSDEIAEKLKVSKASINK
AINTLLDKGLVEREKITEEKRRGRPTFIYYVRKDYMYKKIENDTMNLIFNVKENIKKLLS
ERA
NT seq 372 nt   +upstreamnt  +downstreamnt
atgagtgaaaggttaaagtttccagatggtagggaagtagatattcatgaagtgctatca
ttcctttatggattaggaggaagtgagatccaagtacttcatctattattaacagagggt
aaaatgagaagtgatgaaatagccgaaaaactaaaagtatctaaggcttcaataaataaa
gcaataaacactttactagataaaggactagttgaaagagagaaaattactgaagaaaag
agaagaggaagaccaacattcatatactatgtcagaaaggactatatgtataaaaagata
gaaaatgatacaatgaatcttatatttaatgtaaaagaaaatataaagaaattattgtct
gaaagggcatga

DBGET integrated database retrieval system