KEGG   Sulfurisphaera tokodaii: STK_07520
Entry
STK_07520         CDS       T00062                                 

Definition
(GenBank) putative acetolactate synthase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-ProteinID: BAB65761
UniProt: Q973Z9
Position
complement(731770..733362)
AA seq 530 aa
MGKTTSELLIDTISSQVTDVFGIPGTHGLSLYEELRKRVSRGEITYYMPRLEYGGAIMAD
YYARLKGNVGVFLSVNGPGFTNSLTGLVEAYSEGSPLILISLNKEFKYRHRKQLHDSGYY
DLQLEMARQATKAAFRIYSPEDIPIVMQRAFRIALEDKMGPVYIEVPVDLLEEKSNIEEY
KTNKKINRTLVYPTKEEIKEAVNFLSECSKPILLLGYGASRSNIVNYIERLGIPVLTTIR
GKGSIPENHPLYAGTIFNLTEIPGDCLIAIGTSFNDLETNKWSIKMPRRILHVDPDVNVF
NTSFSAEVTVKASAEAFLEEIVERVNLPKWSYKVDTKKHIESNGEITHDYLAKVLDETLS
EDRVIIADAGTNQVMAMDIKVYRPNSYFNSLIFNAMGSAIPAGIGAKIASPERQIVSIIG
DLGFQGCLNELITAVQYKVNFLTVLVEDGVQHFLRLNQKMRYGNTFATDVFQIDYTKVME
GIGVNVIEVKDKEDLKKNVEEAVGLSIKSPTVLRVHVSPNSIPSRLLMRR
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgggcaaaacaacatctgaacttctaattgacacaatttcttcccaagtaacagacgta
ttcggaattccaggtactcatggtttatcattatatgaagaactcagaaagagagtaagt
agaggagagataacatattacatgcctagactagaatatggaggagccataatggcagat
tattacgctagattaaagggaaatgttggagttttcttgtcagttaatggcccaggcttt
actaattctttgactggtctagttgaggcctattctgaaggttctcctcttatactaata
tctctaaataaggaatttaaatataggcataggaagcagcttcacgattctgggtattat
gatttacaattagaaatggctagacaagcaactaaggctgcttttagaatttactcccca
gaagacattccaattgtaatgcaaagggcttttagaatagctctagaggacaagatggga
ccagtttacatagaagttcccgtcgatctactggaggagaaaagtaatattgaagagtat
aagactaacaagaaaattaataggacattagtttaccctacaaaagaggaaataaaggaa
gcagtaaatttcctaagtgagtgttcaaaaccaattctattgttaggttatggtgcatct
aggtcgaacatcgtaaactacattgagagattaggaattccagtattgactactatcaga
ggaaaagggagtataccagagaatcatcctttatatgccggaacaatatttaacctcact
gaaatcccaggcgattgtctcatagcaatagggacgtcatttaacgatcttgaaactaat
aaatggagtattaaaatgccgaggaggatactccacgtagacccggacgtcaatgtattt
aatacttcctttagtgcggaagttactgtaaaagctagtgctgaagcgtttctagaagaa
atcgttgaaagagttaatttaccaaagtggagttataaagtagataccaaaaagcacata
gaaagtaatggtgaaataactcacgattatttagccaaagttctagatgagacattaagt
gaagatagagttataattgctgacgcagggactaatcaggttatggcaatggatataaaa
gtgtataggcctaattcttactttaattcccttatcttcaacgcaatgggatcagcaatt
cctgctggaataggagctaaaattgcatctccagaaaggcaaatagtaagtattatagga
gatctaggatttcaaggatgtttaaacgagttgattactgcagtgcaatataaggtcaac
ttcctaacggtattagtagaggatggtgtacagcactttctgaggttaaatcagaaaatg
agatatgggaatacttttgcaactgatgtatttcaaattgattacactaaggttatggag
ggaataggggtcaacgtaattgaggtaaaggataaggaagatcttaagaaaaatgtagaa
gaagctgttggattatctattaagagtccaacagttctgagagtccacgttagccctaat
agtataccttctagattattaatgagaagataa

DBGET integrated database retrieval system