KEGG   Sulfurisphaera tokodaii: STK_08070
Entry
STK_08070         CDS       T00062                                 
Symbol
purK
Name
(GenBank) N5-carboxyaminoimidazole ribonucleotide synthase
  KO
K01589  5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00230  Purine metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    STK_08070 (purK)
Enzymes [BR:sto01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.18  5-(carboxyamino)imidazole ribonucleotide synthase
     STK_08070 (purK)
SSDB
Motif
Pfam: ATP-grasp PurK_C ATP-grasp_3 GARS_A DUF3960
Other DBs
NCBI-ProteinID: BAB65820
UniProt: Q973U0
Position
784616..785710
AA seq 364 aa
MKSLTQNSIKIGILGGGQLGWMMILEGRKYPFAFYVMDEPEAPACKVADKCFTPDDYKKM
IDEVDVVTFEFEHVKEEALQYAEDQGKLLPRLNTVELKRERWKEKTYYKEHNLPTPRFYI
ANDGEEALRILKDEFNNVGVLKQSRGGYDGKGQYFIKGDVEKYGFIKDMKCKFVVEEFVN
FNYEASIIAVRDRNGNFKAYPPTFNYNEKGILVYNYGPLKDNRFAEIAKRLMDSLEYVGT
IGIEFFVRDGEILINEFAPRVHNTGHYTLDAAFVSQFEQHLRAITGLEIGATELLSYGGM
VNILGTDNVPLEVLKYGKVYWYGKKEVRKRRKLGHVNVVGSNLEDVKQKIDIIMKLIYPQ
GLDL
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgaagtccttaacacaaaactcgattaaaattggaattttaggaggaggacaattaggc
tggatgatgattttagaagggagaaaatatcccttcgctttttacgtaatggacgagcca
gaagctcctgcatgtaaagtagcggataaatgttttacgccagatgactataagaaaatg
atagatgaagttgacgtagtaacttttgagttcgaacatgtcaaagaagaggcattacag
tatgctgaagatcaagggaaacttttgcccaggttaaatactgttgaattaaaaagggaa
agatggaaggaaaaaacatattataaggaacataatttgccaactcctagattttacatt
gctaacgacggagaagaggcattaagaattcttaaggacgagtttaataacgttggtgtt
ttgaaacagagtaggggaggatatgacggtaaaggacagtattttataaagggagatgtc
gaaaaatacggattcattaaggatatgaagtgtaaatttgtagttgaagaatttgttaat
tttaattatgaggcttctataatagctgttagagatcgaaatggaaattttaaggcatat
ccaccaacattcaactataacgaaaaaggaatcctggtatacaactacggtccccttaaa
gataacagatttgctgagattgcaaagaggttaatggattctttagaatatgtaggtaca
attggtattgagttttttgtaagagatggggaaattctaataaatgagtttgctcctaga
gttcataatactggtcactatactctagatgcagcatttgtttcacaatttgaacaacat
ttgcgagcaataactggcctggaaataggtgctacagagctactctcatatggaggtatg
gtgaatattttaggtacagataatgttcctcttgaagttcttaaatatggtaaagtgtat
tggtatgggaagaaagaagttagaaagaggagaaagttggggcatgtcaatgtagttgga
agtaacttagaagatgttaagcaaaaaattgatattattatgaaactaatttatcctcaa
ggtttagatttatga

DBGET integrated database retrieval system