KEGG   Sulfurisphaera tokodaii: STK_08540
Entry
STK_08540         CDS       T00062                                 
Name
(GenBank) transposase for insertion sequence element
  KO
K07486  transposase
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    STK_08540
SSDB
Motif
Pfam: Transposase_20 DEDD_Tnp_IS110 HHH Sec3_CC HHH_5 FlgN TMCCDC2
Other DBs
NCBI-ProteinID: BAB65867
UniProt: Q973P4
Position
complement(831806..832966)
AA seq 386 aa
MTKDFVSKAFAIDISQSKLTAAKGELVIKQEKPSVTVKEVKEFPYNNEGIEELIKFLEGY
NEGILEATGVYFYYLHEKLTEKGFKVTVVNPAHLTEILGKKTDKLDAQRLLVAYMTGVIK
GSYIPTGEIKELRELTRHRENLVNKITQVKNEIRKTLEIAGYKIEPFDKKGRQLLEKLAK
GEELSKEEKEELKEKLGRNLNDAEKLTLKQLVELLKSLENMVKEVEDMIISKIPKPVIEL
SKIPGIGLITAATIYAEFGDISRFPNSKAARAYAGFAPRTKQSGNSESHSGMIRGNKRLR
RGFYLAARSARWLEPFNEFYERLIARGKSVRQATCALAGKLACIVYHVLKDGVYKGIVKK
RLRIPKGGEVNVKDFDVGDALDSLSP
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgacaaaggactttgtaagcaaagccttcgcaatagacatctcacaaagcaaactaaca
gcagcaaagggagaactagttataaaacaagaaaaaccatcagtaacagtcaaggaagta
aaagaattcccttacaacaacgagggaatagaagagttaataaaattccttgagggatac
aacgagggaatattagaggcaacaggagtatacttctactacctacacgaaaaactaaca
gaaaaaggattcaaagtaacagtagtaaacccagcacacttgacagaaatactaggaaaa
aagacagacaaactagacgcacaaagactactagtagcatacatgaccggagtaataaaa
ggatcatacataccaacgggagaaataaaagaactaagagagttaacaagacatagggaa
aacctagtaaacaagataacacaagtaaaaaacgagataagaaaaaccttggaaattgcc
gggtataaaatagaaccattcgacaaaaaaggaagacaactactagaaaaactagcaaaa
ggagaagaattgagcaaggaagagaaggaagagttaaaagagaaactagggagaaacttg
aatgacgcagaaaaactaacactaaaacaactagttgagttattgaaaagcttggagaac
atggttaaggaagttgaggacatgataatatccaagataccaaaaccggtaatagagtta
tccaagatccctggaattggtttaatcactgcagcaacaatttatgctgaatttggtgat
atctcacgttttccaaactcaaaggcagctagggcttatgcgggtttcgcacctagaaca
aagcagagtggtaatagtgagtcccactctggtatgattaggggtaataagcgcttacgt
aggggtttctacttagctgctaggagtgccagatggcttgaaccatttaacgagttttac
gagaggctcattgctaggggtaagagtgtaaggcaagctacatgtgcacttgcggggaag
cttgcttgcatagtatatcacgttttaaaggacggtgtttacaagggcatagtcaagaag
cgtcttaggatacccaagggtggggaagttaatgtcaaggatttcgacgtgggagacgca
ctggactcgttatccccgtag

DBGET integrated database retrieval system