KEGG   Sulfurisphaera tokodaii: STK_08900
Entry
STK_08900         CDS       T00062                                 
Symbol
pfpI
Name
(GenBank) intracellular protease PfpI
  KO
K26818  archaeal arginyl aminopeptidase [EC:3.4.11.27]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sto01002]
    STK_08900 (pfpI)
Enzymes [BR:sto01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.27  archaeal arginyl aminopeptidase
     STK_08900 (pfpI)
Peptidases and inhibitors [BR:sto01002]
 Cysteine peptidases
  Family C56: PfpI endopeptidase family
   STK_08900 (pfpI)
SSDB
Motif
Pfam: DJ-1_PfpI GATase GATase_5
Other DBs
NCBI-ProteinID: BAB65904
UniProt: Q973K8
Position
complement(868317..868838)
AA seq 173 aa
MKVLFIVGDEYEDIELLYPFYRVIEEGYQPVIAGKEAGAKIVGKHGYSVVADIAFKDVKV
EDYLALVIPGGRGPERIRTLPEVKELTRRFFIDKKPVAAICHGPQVLISAGVIKGRKVTS
VASIKDDIVAAGGEYVDAPLVEDENLISSRHPGDLPYFAKGLLKALKSVREKS
NT seq 522 nt   +upstreamnt  +downstreamnt
atgaaagttcttttcatagttggagatgaatatgaagatattgagcttctgtacccattc
tacagagtaattgaagaaggatatcagccagttattgcaggtaaagaggctggggcaaag
attgttggtaaacacggttattcagttgttgcagatatagcatttaaagacgtgaaggtg
gaagattatttagctttagttattccaggaggaagggggccggagagaataagaactttg
ccagaggttaaagaactaactaggagatttttcatagataaaaagccagtagcagcaatc
tgtcacggtcctcaagtgttgatttctgctggcgtaataaaaggtagaaaagttacttct
gttgcttcaattaaagatgatatagtagctgcaggaggagaatatgtagatgcccctcta
gttgaggatgaaaacttaatttcttcaaggcatccaggggatctgccatactttgctaaa
ggactgttaaaggctttaaaaagtgtgagagaaaaaagctaa

DBGET integrated database retrieval system