KEGG   Sulfurisphaera tokodaii: STK_09160
Entry
STK_09160         CDS       T00062                                 
Name
(GenBank) putative acyl-CoA dehydrogenase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_2 Acyl-CoA_dh_M Acyl-CoA_dh_N Pou
Other DBs
NCBI-ProteinID: BAB65929
UniProt: Q973I4
Position
complement(892645..893721)
AA seq 358 aa
MSEEAELIIQSANELSKQLDSTSEEQGIFPRKNLELLAQQGFMGILIPKPYGLELPAKTF
VDVVKTIAKASPSTAWLYVTHIASTIALHAFANQQVKEKYMKDLVEGKILIGAAGTESVG
GAINAVLNTTAELKGDKYVINGSKTFITGAGELDLYLLISKIQGQQKPGVFLLEKNQVKS
GQKFTSLGMKGISWGELIIENAEVPKDYMIIDDAVKFLGVLGRIGMLGVSAIAYGLAEGA
FEEALNHVKNRKLGQNTLASFEGVQIYLAEMAAKVEALKQMVYQAAEQSTSLPAILKARI
FNTETALEVIDKALRITGGHGFSNALKIEKYYRDVRATMLHFQTLELSKKVLGGLLIA
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtccgaagaagcagagcttattatccaatcagcaaatgaactctcaaaacagctagac
tctacaagtgaagaacaaggaatattcccaagaaaaaaccttgaattattagcgcaacaa
ggattcatgggaatattaataccgaaaccttacggtttagaattaccagcaaaaacattc
gtagatgtagtaaaaaccatagcaaaagcctcaccatcaacagcgtggctttatgtaaca
cacatagcttcaacaatagcattacatgcatttgcaaaccagcaagttaaagaaaaatac
atgaaagacttagttgaaggaaaaatactaatcggagctgctggaacggaaagtgtagga
ggagcaataaacgcagtattaaatactacagcagaattaaagggagataaatacgtaata
aacggttcaaaaacattcataactggtgctggagaactggacttatacttactgatctca
aaaatacaagggcaacaaaaacccggggtattcttacttgagaaaaaccaagtaaagagc
ggacaaaaattcacgtcattaggaatgaaaggaatatcttggggagaattaataattgaa
aatgcagaagtaccaaaggactatatgataattgatgatgcagtaaaattcttaggagta
ttaggaagaataggaatgttaggagtatcagcaatagcttatggtttagcagaaggagcg
tttgaagaagccttaaatcatgtgaaaaacagaaaactcggacaaaatactttagcttca
tttgaaggagtccaaatatacttagcagaaatggcagcaaaagttgaagcactaaaacaa
atggtttatcaggctgcagaacagtccacatcactcccagcaatattaaaagcaagaata
tttaacacagaaacagcactagaagttatcgataaagcactgagaataacgggaggacac
ggatttagtaatgcattaaaaatagaaaaatattatagagatgttagggcaacaatgtta
cacttccaaacattagaattatcaaagaaagtattaggaggattgctgatagcataa

DBGET integrated database retrieval system