KEGG   Sulfurisphaera tokodaii: STK_09230
Entry
STK_09230         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: PhageMetallopep Peptidase_M56 Aspzincin_M35 SprT-like
Other DBs
NCBI-ProteinID: BAK54413
UniProt: F9VNB6
Position
complement(897138..897512)
AA seq 124 aa
MKFQYADDVKELAKIVNEKFELKLNLERIAFIRSQGSRSKAIARTLMLPSQWRFILSPSI
LYIVEVISEKYDNLPCEEKAYVILHELTHIPNSMKGGLRNHNHPHFRKIKKPPYKELKEI
CKHI
NT seq 375 nt   +upstreamnt  +downstreamnt
atgaaatttcagtatgcagatgatgttaaagaacttgcaaaaattgttaatgaaaaattt
gagttaaaattaaatttagaaagaattgcctttataagaagtcaagggtcaagaagtaaa
gcaatagcgagaacattaatgcttccctcacaatggagatttatcttatcgccatcaata
ctttatatagtggaagtaatctcagaaaagtatgataatttgccttgtgaagaaaaagct
tacgtcattctccacgaattgacacacataccaaactcaatgaaaggaggactaagaaac
cataatcatccccatttcagaaaaataaagaaaccaccatataaagaacttaaagaaata
tgcaaacatatttaa

DBGET integrated database retrieval system