KEGG   Sulfurisphaera tokodaii: STK_09290
Entry
STK_09290         CDS       T00062                                 
Symbol
treY
Name
(GenBank) maltooligosyltrehalose synthase
  KO
K06044  (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase [EC:5.4.99.15]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00500  Starch and sucrose metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STK_09290 (treY)
Enzymes [BR:sto01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.15  (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase
     STK_09290 (treY)
SSDB
Motif
Pfam: DUF1953 Alpha-amylase CHDII_SANT-like
Other DBs
NCBI-ProteinID: BAB65941
UniProt: Q973H2
Structure
Position
903223..905337
AA seq 704 aa
MKLLSTYRLQPMKFSEIRNRLDYFVELGVTHLYLSPVLKARPGSTHGYDVVDYNTINDEL
GGEEEYIRLIDEAKSKGLGIIQDIVPNHMAVHHTNWRLMDVLKKGRHSRYYNYFDFYEEE
EKIRIPILGDRNFKITYVNDEPYLDYYGNLFPINDEGRNYLNDIEKLLKVQYYELVDWRD
YPSYRRFFAVNELIAVRQELEWVFEDSHSKILSFEVDGYRIDHIDGLFKPEEYLRRLKNK
IGNKHIFVEKILSIGEKLRWDFIDGTTGYDFLNYSNLLFTDNEDKMTEIYKNILDIDLDE
LVKETKKKIIDTLFKHDIERISMMLGVNYEEIKEFLSCLKVYRTYITENDFRDEEIIRNC
SQKVYESMKKNVTAFMKLQQYMPAVFAKAYEDTVLFIYNRLISLNEVGSDLHYYSISCDK
FHEFNLKRVGTLSFNATSTHDTKFSEDVRMRISAISEIPDEWAKKVNEWHNILNPNIDKN
DEYRLYQTIVGSFDGFNNEYKERLKAHMIKALREAKVHTDWVNVNTEYEKKMTYLIDKMF
NNEKFMESFLEFESKIDKMGKVKSLSLVALKITSPGVADFYQGLENFRYLLTDPDNRRPV
VFSELPKRYEEGLFNNGRIKAYVTKVLLNLRKSMKDFFINSEYKPLKLQKGLCGFMRGDK
VLVIVKTLNRDYDIEIDGEYTDVITDETVRGRVKVDKLPLILVK
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgaagttactttcaacctataggcttcaaccaatgaagttttccgaaattagaaatagg
ctggattattttgttgaacttggagttactcatctttatttatcaccagtcttaaaggct
aggccagggagtactcatggatatgacgttgtagattataataccattaacgatgaactc
ggtggagaagaggagtatataagattaattgatgaagctaaaagtaaaggtttaggaatt
atacaagatattgtaccaaatcatatggctgttcatcatactaattggagattaatggat
gtattaaagaagggaaggcatagtagatattataattatttcgatttctatgaggaagag
gaaaagataaggattccaattcttggagataggaattttaagataacttatgttaatgat
gagccttacttagattactatggaaatctttttcctataaatgatgagggaaggaattat
cttaatgatatcgagaagttattaaaggttcaatattatgaacttgttgattggagggat
tatcctagttataggagattttttgctgtaaatgaattaattgctgttagacaagagctt
gagtgggtttttgaagattctcattcgaaaattctttcttttgaagtagacggatatagg
attgatcatatagatggtttatttaaaccagaggaatatttaaggcgattaaagaataaa
ataggaaataaacatatttttgtggaaaaaattttatctataggtgagaagttaagatgg
gattttattgatggtactacgggttatgattttctaaattattctaatcttctttttact
gataacgaagataaaatgacagagatatataagaacatattagatatagatctagatgaa
ctcgtgaaagaaactaaaaagaagataattgatacattattcaaacatgatatcgaaaga
atttctatgatgttaggcgtgaattatgaagagattaaagagtttctctcgtgtttaaaa
gtatataggacttatataactgagaatgattttcgagatgaagaaataataaggaactgt
agtcaaaaagtttatgaaagtatgaagaagaatgttactgcttttatgaaattacaacaa
tatatgcctgcagttttcgctaaagcatacgaagatacggttctttttatatataatagg
ctaatttctttaaatgaggttggtagcgatttacattattactcaatttcttgtgataaa
tttcatgagtttaatctaaaaagggtcggtactttatcgtttaatgctacttcgacccat
gatacgaagtttagcgaagatgttaggatgagaattagtgctatctcagagataccagat
gaatgggctaagaaggttaatgaatggcataatattcttaaccctaatattgataaaaac
gatgaatatagactttatcagactattgtaggtagttttgatgggtttaataatgaatat
aaggagaggctaaaggctcatatgattaaggctttaagagaggctaaagttcatacagat
tgggtgaatgtaaatactgaatatgaaaagaagatgacttatctaattgataaaatgttt
aacaatgagaaattcatggaaagttttcttgaattcgaaagtaaaattgataagatgggt
aaagttaaatctctttctttagttgctttaaaaataacatctccaggtgttgctgatttt
tatcagggtttagagaattttagatacctactaaccgacccagataatagaaggccagta
gttttttctgaacttccaaagagatatgaggaggggttgtttaataatggtaggataaag
gcctatgtcactaaggttcttctaaatttaaggaaaagtatgaaagatttctttatcaac
agcgaatataagcctttgaagctacaaaagggattatgtggtttcatgcgaggagataaa
gttctggttattgttaagactttaaatagagattatgatatcgagatagatggtgaatat
actgatgtaattactgatgagactgtaagaggtagagtgaaagttgataaattaccttta
attcttgttaaatag

DBGET integrated database retrieval system