KEGG   Sulfurisphaera tokodaii: STK_09620
Entry
STK_09620         CDS       T00062                                 
Symbol
sucD
Name
(GenBank) succinyl-CoA synthetase alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00020  Citrate cycle (TCA cycle)
sto00640  Propanoate metabolism
sto00660  C5-Branched dibasic acid metabolism
sto00720  Carbon fixation pathways in prokaryotes
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
Module
sto_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sto_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STK_09620 (sucD)
   00640 Propanoate metabolism
    STK_09620 (sucD)
   00660 C5-Branched dibasic acid metabolism
    STK_09620 (sucD)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    STK_09620 (sucD)
Enzymes [BR:sto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     STK_09620 (sucD)
SSDB
Motif
Pfam: CoA_binding Ligase_CoA CoA_binding_2 Succ_CoA_lig Radical_SAM GFO_IDH_MocA HCV_NS5a_C
Other DBs
NCBI-ProteinID: BAK54426
UniProt: F9VNR8
Position
complement(937341..938120)
AA seq 259 aa
MLTYGTKIVAGVSPGKGGTTVHGVPVYDTIEDALKEHEIDASIVFVPAKYAPDAIYEAID
GGIKLVVVITEHIPVLDMLKIVKYAKTKGTRIIGPNCPGLIVPEESLIGILPPRPFKKGK
VGIVSRSGTLTYEVAEMVKKDYGQSTVIGIGGDPIIGTDMIEIVKMFEEDPETESIVMIG
EIGGTMEERVAKMKAEGKIKKKIVAYIAGMTAPREKRMGHAGAVVYMGMGTFESKIKALT
EAGIPVAKTPYEIPKLLSS
NT seq 780 nt   +upstreamnt  +downstreamnt
atgctcacttacggaactaaaattgttgctggagtaagtccaggcaaaggtggaactact
gttcatggggtaccagtttacgatactattgaagatgccctcaaagaacacgaaatagat
gcaagtatagtatttgtaccagcaaaatatgcaccagatgctatctacgaagcaattgac
ggtggaataaaattagttgtagtaataacagaacacataccagtccttgatatgttgaaa
atcgttaaatatgctaaaacaaaagggactagaattattggtccaaattgccccggtcta
atagttccagaagagagcttaataggaattcttccacctagaccttttaagaaagggaaa
gttggtatcgtatctaggtctggaacattaacatatgaagtagctgaaatggtgaaaaaa
gattatgggcaatctactgttattggaattggcggagatcctataataggaactgatatg
attgagattgtaaaaatgttcgaagaagacccagaaacagaaagtatagtaatgatagga
gaaattggcggtacaatggaagagagagttgcaaagatgaaagctgaaggaaagataaag
aaaaaaatagttgcatatattgcaggcatgacagcaccaagagaaaaaagaatgggtcat
gctggtgcggtagtttatatgggtatgggaacatttgaaagtaaaataaaagctttaaca
gaggctggaataccagttgcaaaaacaccttacgaaatacctaagttactttcttcttga

DBGET integrated database retrieval system