KEGG   Sulfurisphaera tokodaii: STK_09670
Entry
STK_09670         CDS       T00062                                 

Gene name
ogt
Definition
(GenBank) putative O(6)-methylguanine-DNA methyltransferase
  KO
K00567  methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sto03400]
    STK_09670 (ogt)
Enzymes [BR:sto01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.63  methylated-DNA---[protein]-cysteine S-methyltransferase
     STK_09670 (ogt)
DNA repair and recombination proteins [BR:sto03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    STK_09670 (ogt)
 Prokaryotic type
    STK_09670 (ogt)
SSDB
Motif
Pfam: DNA_binding_1
Other DBs
NCBI-ProteinID: BAK54430
UniProt: Q973C7
Structure
PDB: 
1WRJ

Position
942550..943020
AA seq 156 aa
MIVYGLYKSPFGPITVAKNEKGFVMLDFCDCAERSSLDNDYFTDFFYKLDLYFEGKKVDL
TEPVDFKPFNEFRIRVFKEVMRIKWGEVRTYKQVADAVKTSPRAVGTALSKNNVLLIIPC
HRVIGEKSLGGYSRGVELKRKLLELEGIDVAKFIEK
NT seq 471 nt   +upstreamnt  +downstreamnt
atgatagtttacggtctttataaaagcccttttggtccaataacagtagctaaaaatgaa
aaaggatttgttatgctagatttttgtgattgtgcagagaggagttctcttgataatgat
tattttacagacttcttttataaattagacttgtactttgaagggaagaaggttgatcta
acagagcctgtagattttaagccttttaatgaatttaggataagagtatttaaagaagta
atgagaataaagtggggtgaggtaaggacttataagcaagtggctgatgctgttaagacc
tcacctagagctgttggtacagcgttatccaaaaataatgttctattaataataccatgt
catagggttataggagaaaaaagcttaggtggatattcaagaggggtagagttaaagaga
aaattgcttgaattagaaggaatagatgtggctaaattcatagaaaaataa

DBGET integrated database retrieval system