KEGG   Sulfurisphaera tokodaii: STK_09680
Entry
STK_09680         CDS       T00062                                 
Name
(GenBank) putative sugar-phosphate nucleotidyltransferase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 IspD DUF4224
Other DBs
NCBI-ProteinID: BAB65987
UniProt: Q973C6
Position
943087..943773
AA seq 228 aa
MKAVILAGGYGKRLRPLTDDKPKPLVEVAGKPIIEWQIHWLKSFGITSFFVLAGYKKEAL
IEWISKNQQRLNVSIATLTEEEPLGTGGAIRRLKDFISDDFIVINGDILTNIDINKMVLK
DCIVAIALVPLRSPYGIVSIDDNGKIIRFVEKPLLKEYWINAGVYKMKPEVFEYLPEKGD
IEKITFPSLAEKGLLKGVTYENVYWRSIDTIKDYEEASVEIPEVFKKL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgaaagctgtaattttagctggaggttacggtaaaagattaagacctttaactgatgat
aaacctaaacccctagtagaagttgctggaaaacctattatagaatggcaaatacattgg
ttaaagagttttggtattacttctttctttgtgttagctggttacaaaaaagaagctctc
attgaatggatttcaaaaaatcaacaaagacttaatgtgtcaattgctacattaacagaa
gaagaaccattaggtaccggtggtgcaataagaagacttaaagatttcataagtgatgat
ttcatagttataaatggagatatacttactaacattgatattaacaagatggtgttaaaa
gattgtattgtagctatagctctagttcctttaaggagcccatatggtattgtaagtata
gatgacaatggaaaaataatacgttttgtcgaaaaacccttattaaaagaatactggata
aatgctggtgtttacaaaatgaaaccagaggtttttgaatatttaccggaaaaaggagat
attgaaaaaataacgtttccgtctctagctgaaaaaggtttacttaaaggagtaacttat
gaaaacgtttactggagatcaatagatactataaaagattatgaagaagcatcagtagag
ataccggaagtatttaagaagttatga

DBGET integrated database retrieval system