KEGG   Sulfurisphaera tokodaii: STK_10020
Entry
STK_10020         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: PRP21_like_P Glyco_hydro_35 Gmx_para_CXXCG DUF4943
Other DBs
NCBI-ProteinID: BAB66026
UniProt: Q972Y7
Position
980860..981435
AA seq 191 aa
MVSLFKALMMIGFEHVAPRTLQRGNTTIFVYHSIYGLKWVINTQFGSASYYSQKDALHGL
VLRLVISKEELEFLASLGIHYAREELENYERTLKKIEAGGIKAIREYLRSLEKREENNTN
LKNIEMQFRKQVIYPYLERILVETKSRCPICGRLMIETEEFYNHLRSSRYRKMEHEEFFR
KIIEEITNLSP
NT seq 576 nt   +upstreamnt  +downstreamnt
atggtctcgctttttaaagccctcatgatgataggttttgaacatgtagcacctagaact
ctacaaagaggaaatacaactatatttgtttaccatagcatatacggtttaaagtgggta
attaatactcaattcggtagtgccagttactatagtcaaaaagatgcccttcacggttta
gtccttagacttgtaattagtaaagaagaattagaatttttagcgtcattaggcattcat
tatgccagagaagagctagagaactacgaaagaacgttaaagaaaatagaagctggaggg
ataaaagctataagagaatatttgagatcgcttgagaaaagagaggaaaacaacacaaac
ttaaaaaatattgaaatgcagtttagaaagcaagtgatttacccctacttagagaggatt
ctggtagaaactaaaagcagatgtccaatatgtggtaggctaatgatagagactgaagaa
ttttataaccatttaaggagtagtagatacagaaaaatggaacatgaagaattctttaga
aaaattatcgaagagataactaatctttcaccttaa

DBGET integrated database retrieval system