KEGG   Sulfurisphaera tokodaii: STK_10100
Entry
STK_10100         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Oxidored_molyb TAT_signal
Other DBs
NCBI-ProteinID: BAB66034
UniProt: Q972X9
Position
complement(992273..992899)
AA seq 208 aa
MKRRDFLKALFISTSLLVIGRLSLYEYNNYQHVQNALTPFGSWYVVQIAGTPEISVNNYV
LTVDGEVENPIRLTYQDLLKMPSIEVKDTIQCVSDPYFLRANVVWTGVPLKYIIDMVKPS
PNVIKVIGYGAEGYTADLPISKAMEPNVIIAYMVDGKPLPQVHGYPVRLAVPGWWGYTYV
KWLVRLYFTSKNILGYWESRGYPDYAKK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaaaaggagagatttcctaaaggcattattcatctcaacctcactattagttattggc
agattatcattatatgaatataataattatcaacatgtgcaaaacgcattaacacccttc
ggatcatggtatgtagttcagatagccggtactccggaaattagtgtaaataattatgtc
ttaactgttgacggtgaagtagaaaatcctattagactcacttatcaagatcttcttaaa
atgccttcaatagaggttaaagacaccatacagtgtgtttccgacccttattttttaaga
gctaacgtagtatggacaggagtacctctaaagtacataattgatatggttaaaccttca
ccgaatgtaattaaagttataggctatggtgcagagggatatactgctgatcttccaatc
tcaaaagcaatggaaccaaacgtaattattgcctatatggttgatggaaaacccctacca
caggttcatggttatccagtgaggttagctgttccaggctggtggggatatacttacgtt
aaatggttagtcagactttacttcacttctaaaaacatcttaggttattgggaatctagg
gggtatccggactatgcaaagaagtaa

DBGET integrated database retrieval system