KEGG   Sulfurisphaera tokodaii: STK_10220
Entry
STK_10220         CDS       T00062                                 
Symbol
grp
Name
(GenBank) glutamine receptor protein
  KO
K03719  Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sto03000]
    STK_10220 (grp)
   03036 Chromosome and associated proteins [BR:sto03036]
    STK_10220 (grp)
Transcription factors [BR:sto03000]
 Prokaryotic type
  Helix-turn-helix
   Lrp/AsnC family
    STK_10220 (grp)
Chromosome and associated proteins [BR:sto03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucleoid associated proteins
    STK_10220 (grp)
SSDB
Motif
Pfam: HTH_24 HTH_AsnC-type AsnC_trans_reg HTH_20 HTH_5 MarR MarR_2 HTH_23 HTH_27 HTH_28 HTH_34 HTH_38 Fe_dep_repress UPF0122 TrmB Rrf2 HTH_11 HTH_IclR HxlR HTH_30 RuvB_C HTH_10 CENP-B_N HTH_WhiA HTH_Crp_2 HTH_1
Other DBs
NCBI-ProteinID: BAK54442
UniProt: F9VNT4
Structure
Position
1007929..1008381
AA seq 150 aa
MDEIDLRILKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPASLN
LDYIVITSVKAKYGKNYHVELGNKLAQIPGVWGVYFVLGDNDFIVMARYKTREEFMEKFL
ERVMSIPEVERTSTQVVVKIIKESPNIVIF
NT seq 453 nt   +upstreamnt  +downstreamnt
atggatgaaatagatttaagaattttgaaaattcttcaatataatgcaaaatattcttta
gatgagatagctagggaaattagaattcccaagtctaccttatcatatagaattaagaag
ttagaaaaagatggtgtaattaagggttattatgcatatattaatccagcctcattaaac
cttgattacatagtaataacttctgtaaaagctaagtatggtaaaaattatcatgtggag
ttaggcaataagttagcacaaataccaggggtttggggagtatattttgttctaggtgat
aatgattttattgtaatggctagatataaaaccagagaggagttcatggaaaaattctta
gaaagagttatgagtattccagaggttgagagaacttctacacaagttgttgttaagata
attaaagaatcaccaaatatagttatcttttaa

DBGET integrated database retrieval system