KEGG   Sulfurisphaera tokodaii: STK_10450
Entry
STK_10450         CDS       T00062                                 

Definition
(GenBank) putative nucleotide-binding protein
  KO
K03593  ATP-binding protein involved in chromosome partitioning
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sto03036]
    STK_10450
   03029 Mitochondrial biogenesis [BR:sto03029]
    STK_10450
Chromosome and associated proteins [BR:sto03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    STK_10450
Mitochondrial biogenesis [BR:sto03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    STK_10450
SSDB
Motif
Pfam: ParA AAA_31 CbiA ArsA_ATPase MipZ
Other DBs
NCBI-ProteinID: BAB66075
UniProt: Q972T8
Position
complement(1032819..1033520)
AA seq 233 aa
MEPLRELAKDKLKDKKVIAIMSAKGGVGKSVISALISLSLPSDLTLIDLDIHTMAIAKLF
GVENVPLEVSKEGIEPVKIRNVNLISLAGIVRDRYVILPGRNQTNVMKELIAYSSIKGEY
VVFDLPPGLGDEILVLEELSDFKPIVVTTPSKVSLKVVKYLLDYLNERKKKALVVVNMSY
FNCNDQRVNPFGNYNGDVNLPIDPNLEDYIGKIQEYEGEVKKVIEKELIPQFM
NT seq 702 nt   +upstreamnt  +downstreamnt
atggagccgttgagagagttagctaaagataaactaaaagataaaaaagtaattgctatt
atgagtgctaaaggtggtgttgggaagagcgtaatatcagcgttaatatccctctcctta
ccttcagatttaacgttaattgatcttgatatacatacaatggcgatagcaaaattgttt
ggagtagaaaatgttcctttagaagtgagtaaggaaggaatagagcctgtgaaaataaga
aatgttaatttgatttctcttgcaggaatagtaagagatagatatgttattttacctggg
agaaaccaaactaatgttatgaaggagttaatagcttattctagcataaaaggagaatat
gttgtttttgacctacctcccggtcttggcgatgaaatattagtacttgaagagctaagc
gattttaaaccaatagtggtcactacaccttcaaaagtatcattaaaagttgtaaaatac
ttgttagattatttaaacgagaggaaaaagaaggcactagtagtagttaacatgtcatat
tttaattgtaatgatcaaagagttaatccatttggaaattataatggagatgtaaattta
ccgatagatcctaatctagaggactacataggaaaaatccaggaatatgagggagaagta
aagaaggttattgagaaagaattaatacctcaatttatgtag

DBGET integrated database retrieval system