KEGG   Sulfurisphaera tokodaii: STK_10480
Entry
STK_10480         CDS       T00062                                 
Name
(GenBank) transposase for insertion sequence element
  KO
K07491  REP-associated tyrosine transposase
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    STK_10480
SSDB
Motif
Pfam: Y1_Tnp
Other DBs
NCBI-ProteinID: BAB66078
UniProt: Q972T5
Position
1034980..1035390
AA seq 136 aa
MEYKSTRHAKYLCNYHFLWIPKYRRKVLTGEIAEYTKEVLRTIAEELGCEVLALEVMPDH
IHLFVNCPPRYAPSYLANYFKGKSARLILKKFPELKKATNGKLWTRSYFVSTAGNVSSET
IKKYIEEQWAKENEED
NT seq 411 nt   +upstreamnt  +downstreamnt
gtggaatacaaatcaactaggcatgcaaagtacctctgcaactaccacttcttatggata
ccgaaataccgtaggaaagtgctaacaggcgaaatagctgaatacactaaagaggtacta
agaaccatagcagaagagttgggctgtgaagtattagccctagaagtaatgccagaccac
atccacctcttcgttaactgcccaccgagatacgcaccgtcatatttagcaaactacttc
aaaggaaaatcggcaaggctaatcctcaagaagttcccagagctgaagaaagctactaac
gggaagctatggactagaagctacttcgtatctaccgcaggtaacgtatccagcgagacg
ataaagaagtacattgaagaacagtgggcgaaagagaatgaagaggactaa

DBGET integrated database retrieval system