KEGG   Sulfurisphaera tokodaii: STK_10600
Entry
STK_10600         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: HTH_IclR HTH_24 TrmB MarR_2 HTH_5 HTH_20 HTH_27 HTH_AsnC-type HTH_36 MarR HTH_11 Chordopox_A13L Replic_Relax DUF5775 TM_ErbB1 Rrf2 RNA_pol_Rpc34 LexA_DNA_bind DprA_WH ASFV_J13L
Other DBs
NCBI-ProteinID: BAB66089
UniProt: Q972S5
Position
complement(1046662..1046997)
AA seq 111 aa
MEHQLIILLLIADIVLISLIVYFFLRRRKEARKVESAEEENAELVTDVLDERDKLVLNAL
KDGSFTLAEIIRKTGLPKATAYRRLKKLVKLGYVEEVRERGKIRYVLKKKD
NT seq 336 nt   +upstreamnt  +downstreamnt
atggagcaccagcttattatattgcttttaatcgcagatatcgttctaatatctctcata
gtttacttcttcttgagacgaaggaaggaagcaagaaaagtagaatcagcagaggaagaa
aatgcagaattagttactgatgttttagacgaaagagataagcttgtacttaatgcatta
aaagacggttctttcactttagctgagattataagaaaaaccggtttgcctaaagcaacc
gcttatagaaggttaaaaaaattggttaaacttggttatgtggaggaagttagagagagg
ggtaaaattaggtatgtgttaaagaaaaaagattag

DBGET integrated database retrieval system