KEGG   Sulfurisphaera tokodaii: STK_10750
Entry
STK_10750         CDS       T00062                                 
Symbol
merA
Name
(GenBank) mercuric reductase
  KO
K00520  mercuric reductase [EC:1.16.1.1]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    STK_10750 (merA)
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.1  mercury(II) reductase
     STK_10750 (merA)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox_3 Pyr_redox GIDA HI0933_like Baculo_E56 FAD_oxidored
Other DBs
NCBI-ProteinID: BAK54452
UniProt: F9VNU4
Position
complement(1059125..1060486)
AA seq 453 aa
MRLVIVGNGAAAFAALIRANELGVKPVMISHGIIGGTCVNVGCVPSKRMLRIGEVYDYTR
KTLGKDVYPDFFKAFEDKQEIVETLRKEKYIDVLSSYDVEYVEGKAHFVSPKEVKVNGKI
IEGDKFIIATGSSPQIPDIPGLKELGYWTNVEALSPNRKISSLAVIGGRALALEFAQMYK
RLGVDVLILQRSKIIIPNWEPEISIAVQNYLSKEEGIYIVTDVKIKEIKKGDEGGKIIVT
DKGEAEVDEILVATGRRPNVDLNLDVAGVKLNEKGGILVNETLQTTNPNIYAAGDVIGDL
MLESLAGKEGSVAAENAILNSGKKIDRLSIPQVIFIEPNVARVGLTYLEAQREYSVESRV
VKMSSVAKARILREPQGLIKMNVDKNTKKILGVQMFGKYAAEVINEAALAIRLRATIDDI
IDTVHVFPTMAESLKLAAMSFYRDVDKMSCCVD
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgagattggtaattgtaggtaatggggcagcagcatttgcagcattaataagggctaac
gaacttggagttaaaccagtaatgattagtcacggaattataggtggaacttgcgttaat
gtaggttgtgtgccctcaaaaagaatgttaagaataggtgaagtttacgattacacaaga
aaaactttaggaaaagatgtatacccagattttttcaaagcatttgaagataaacaagaa
atagttgagactttaagaaaagaaaaatatatagatgttttatcctcatatgacgtagaa
tatgtggagggaaaagcacactttgtctcccctaaggaagtaaaggttaatggtaaaata
attgagggagataagttcataattgcgacgggttcttctcctcaaataccggatataccg
gggctgaaagaactcggttattggacgaatgtagaagctttatcaccaaacagaaaaatc
tcctcgctggctgttattggtggaagagctttagcattagagtttgcacagatgtacaaa
aggctaggagtagatgttttaatacttcaaagaagtaagataataatacccaattgggaa
ccagaaatttcaattgcagttcaaaactacttgtcaaaagaagagggcatatatattgtt
actgacgttaaaattaaagaaattaaaaaaggagatgaaggagggaaaataatagtaact
gataaaggtgaagcagaagtagacgaaattttagttgcaaccggaagaagacctaatgta
gacttaaacttagatgtagcgggagtaaagctaaacgagaaagggggaatattagttaat
gaaacacttcaaacaacaaaccccaatatctacgctgctggagatgtaatcggagattta
atgcttgaatctttagccggtaaagaaggttcagtagctgctgaaaatgctatattaaac
tctggtaaaaagatagacagacttagtataccacaagtaatattcatagaacctaacgtt
gcaagagtagggcttacttatctcgaggcacagcgtgaatactcagttgaatcaagagta
gttaagatgagtagtgttgctaaagccagaatattaagggagccccaaggattaataaaa
atgaatgtggataaaaatacaaagaaaatactgggagtacagatgtttggaaagtatgct
gctgaagtaataaatgaggctgcattagcaattagattaagggcaacgatagacgatata
atagatactgttcacgtattccctacaatggctgaaagcttaaaactagctgcaatgtcg
ttctacagagatgtggataaaatgagctgttgtgttgactaa

DBGET integrated database retrieval system