KEGG   Sulfurisphaera tokodaii: STK_10760
Entry
STK_10760         CDS       T00062                                 
Symbol
merR
Name
(GenBank) mercury resistance operon repressor MerR
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: HTH_5 TrmB HTH_20 HTH_34 HTH_24 HTH_9 HTH_38 TFIIE_alpha Rrf2 Sigma70_r4 HTH_11 HTH_IclR HTH_PafC DUF4423 HTH_23 Sec3_C_2 DUF2551 MarR_2
Other DBs
NCBI-ProteinID: BAK54454
UniProt: F9VNU6
Position
1060746..1061087
AA seq 113 aa
MEPLLTELERLFSALSDRTRLSITLLLLEKGELTVDEISKDLKKSQSLISHHLSCLRNCG
IVKVRKDGKYSLYSIASDNVAELIKVAMRIIKDYSESILGCEVLNEEKHVVKS
NT seq 342 nt   +upstreamnt  +downstreamnt
gtggagcctttactaactgaattggaaagactgttctctgctttgtcagataggactaga
ttaagtataacacttttacttctagaaaaaggagagttaactgtagatgagatcagtaag
gatctgaaaaagtctcagtctctaatttctcaccatttatcttgtttaaggaactgtggg
attgttaaggtgagaaaagacggaaagtattctttgtattctattgcaagtgataatgtt
gcagagttaataaaagtggctatgaggattataaaggattatagtgagtcaatacttggt
tgtgaggttttaaatgaagaaaaacatgttgtaaagtcttga

DBGET integrated database retrieval system