KEGG   Sulfurisphaera tokodaii: STK_11150
Entry
STK_11150         CDS       T00062                                 
Name
(GenBank) putative Lrp family transcriptional regulator
  KO
K03719  Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sto03000]
    STK_11150
   03036 Chromosome and associated proteins [BR:sto03036]
    STK_11150
Transcription factors [BR:sto03000]
 Prokaryotic type
  Helix-turn-helix
   Lrp/AsnC family
    STK_11150
Chromosome and associated proteins [BR:sto03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucleoid associated proteins
    STK_11150
SSDB
Motif
Pfam: HTH_24 HTH_AsnC-type AsnC_trans_reg HTH_5 HTH_20 MarR HTH_IclR HTH_11 HTH_27 MarR_2 DUF1759 HTH_WhiA RuvB_C HTH_30 DDRGK TFIIE_alpha
Other DBs
NCBI-ProteinID: BAB66148
UniProt: Q972L7
Position
1104652..1105107
AA seq 151 aa
MDEIDLKILKILQKDAKYSLEDLSTELKMPKSTVAYRIKRLESLNIIKGYYAQIDPTALN
LDYIVISLIRGKYSKDYHIELGSKLANIPGVWGVYFVLGDTDFIVIARYRNREDFMKNYL
ERITSMPEVERSSTHVVVKIIKESPNMVIWW
NT seq 456 nt   +upstreamnt  +downstreamnt
atggatgaaatagatttaaagattctaaaaatacttcagaaagatgcaaaatactcatta
gaagatttaagtactgaattgaaaatgcctaagtcaacagtagcatataggattaagaga
ttggaatctttaaatattataaaagggtattatgctcaaatagatcctaccgcattaaat
ctagattatatcgtaatcagcttaataagaggcaaatacagtaaagactatcatatagaa
ttgggctctaagctagctaatattcctggcgtatggggtgtgtattttgtattgggtgat
acagatttcatagtaatcgctagatatagaaatagggaagattttatgaaaaactattta
gagagaataacaagtatgccagaagtcgaaagatctagtacacatgttgtagttaaaata
attaaggagtctcctaatatggttatttggtggtaa

DBGET integrated database retrieval system