KEGG   Sulfurisphaera tokodaii: STK_11270
Entry
STK_11270         CDS       T00062                                 
Symbol
sor
Name
(GenBank) sulfur oxygenase/reductase
  KO
K16952  sulfur oxygenase/reductase [EC:1.13.11.55]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00920  Sulfur metabolism
sto01100  Metabolic pathways
sto01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    STK_11270 (sor)
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.55  sulfur oxygenase/reductase
     STK_11270 (sor)
SSDB
Motif
Pfam: SOR
Other DBs
NCBI-ProteinID: BAB66162
UniProt: Q972K4
Structure
Position
1121037..1121972
AA seq 311 aa
MPKPYVAINMVEVRNDPKTLELFGKVGPKVCMVTARHPGFVGFQNHVQIGVVPLGTRWGG
AKMEMSQEMHSLMLMQYTFWKNWKDHEEMHKQNWANLFRLCLQCADQMIWGPYEPLYEIV
YANMPLNTEMTDFTVMVGKKFAAGEAVSIPPISQPYGKRVVAFGEHIVKEGLENQFEEYA
IKTLEAFRSAPGFLGGMILKEIGVSPLGSLQLNAKGFHQILETANGMDVPEPVTIYEAPE
FRNRPQRYIVHTEWSDTNALMFGLGRVLIYPEVRQIHDKVLDTLVYGPYIRVLNPMMEGT
YWREYLNEYHL
NT seq 936 nt   +upstreamnt  +downstreamnt
atgccgaaaccatatgtagcaataaacatggtagaagtaagaaatgatcctaaaacgtta
gaactttttggaaaagtaggacctaaagtatgcatggtcacagcaagacatccagggttt
gtgggattccaaaatcatgtacagataggtgtagtacctctagggactagatggggaggt
gctaaaatggaaatgagccaagaaatgcacagcttgatgttaatgcaatataccttttgg
aagaattggaaagatcatgaggaaatgcataaacagaactgggctaatctctttaggtta
tgtctacaatgtgcagaccaaatgatttggggaccttatgaacctttatatgaaatagtt
tatgccaatatgcctcttaatacagaaatgacggatttcacagttatggtaggtaagaag
tttgccgctggagaagctgtatctattcctccaatttctcaaccttacggaaagagagtt
gttgccttcggagagcatatagtaaaagagggattagagaatcaatttgaggaatatgct
ataaaaactcttgaagctttcagatcggctccaggattcctaggagggatgatacttaaa
gagattggagtatcacctttaggaagtttacaactaaacgcaaaaggatttcatcaaata
ttagagacagctaacggaatggatgtaccagaaccagtaacaatttatgaagctccagaa
ttcagaaatagacctcagaggtatattgttcatacagagtggagtgatactaatgcactt
atgttcggtcttgggagagtattgatatacccagaggtaaggcaaatccacgataaagta
ctagatacattagtatatggaccttacataagagtattgaatccaatgatggagggaacg
tactggagagagtacctgaatgaatatcatttataa

DBGET integrated database retrieval system