KEGG   Sulfurisphaera tokodaii: STK_11390
Entry
STK_11390         CDS       T00062                                 
Name
(GenBank) putative transposase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: HTH_23 Zn_Tnp_IS1 HTH_38 Terminase_5 HTH_28 Sigma70_r4_2 HTH_Tnp_1 zf-ribbon_3 HTH_Tnp_ISL3 HTH_29 DUF1804 HTH_40 GerE Zn_Tnp_IS1595 CENP-B_N OrfB_Zn_ribbon RNA_POL_M_15KD
Other DBs
NCBI-ProteinID: BAB66174
UniProt: Q972J2
Position
complement(1134279..1135013)
AA seq 244 aa
MGRKPVIRHDIACPSCGSHHVVKCGKPLGRQRFLCRDCGKYFLADAVYHHHSKEVREEAL
RMYTNGMSMRAISRVLNVPLGTVFTWVKRYGKRKYEKLVDLWNKAKELVKGKVVTKVVDE
MWTYLYRNTRAFYKWVFTCHVYTRLGLYIIYSVGDRDENTFSEVKMYLPDDGRWVSDDYN
VYFWLKDHTVVSPVNPNESFHSSLRDRLVRFKRATKAVNRSINMVKYSIALVLWERRLIP
EFVA
NT seq 735 nt   +upstreamnt  +downstreamnt
atgggtaggaagcctgtaattaggcatgatatagcttgtccctcttgtggtagtcatcac
gtcgttaagtgtggtaagcctcttggtaggcagaggtttctgtgtagggattgcggtaag
tactttcttgcagacgcggtttatcaccaccactctaaggaggtgagggaggaggctttg
aggatgtatactaatggtatgagtatgagggctatttctagggttcttaacgtacctctg
ggtactgtttttacttgggttaagcgttatggtaagaggaagtatgagaagctagtggac
ttgtggaataaggctaaagagttggtcaagggtaaggtcgttactaaggttgttgatgag
atgtggacatacttgtacagaaacactagggctttctacaagtgggtgtttacttgtcac
gtgtacactaggctagggttatacataatttactctgtgggtgatagggatgagaatact
ttcagtgaggttaaaatgtacttgccagatgatggtagatgggtgagtgatgattacaac
gtttacttttggttaaaggatcacacggtagtctcacctgttaaccccaacgagtccttt
cactcctcactgagggataggctcgtacgtttcaagagggcgacgaaggctgttaacagg
agtataaatatggtgaagtattctatagcgctggtcttgtgggagagaaggctaatccca
gaatttgtagcttaa

DBGET integrated database retrieval system