KEGG   Sulfurisphaera tokodaii: STK_11930
Entry
STK_11930         CDS       T00062                                 
Name
(GenBank) hypothetical protein
  KO
K03800  lipoate---protein ligase [EC:6.3.1.20]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00785  Lipoic acid metabolism
sto01100  Metabolic pathways
sto01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    STK_11930
Enzymes [BR:sto01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.20  lipoate---protein ligase
     STK_11930
SSDB
Motif
Pfam: BPL_LplA_LipB
Other DBs
NCBI-ProteinID: BAB66234
UniProt: Q972D5
Position
1195563..1196285
AA seq 240 aa
MRLIIEGGERGERQMALDETMLLLLTKDLIPETVRFWNFKPTTLTLGRFLAVKDWVNEEE
LRRFNFPLIRRFTGGGPALHDENGEITWSVAIKGNDLMKAYQTIAKALINALSHFDLKGE
FSPINDIVVQGKKIVGMAGAIKRNSILVHGTFMYATNPEFMRVIKSPKVKEAERGEAKSR
VTTVSLLLGYNISRSEALEALIEGFKSVFNLEDGELTDIEKEFSESLRFKYTNPQWTYLR
NT seq 723 nt   +upstreamnt  +downstreamnt
atgagacttataattgaaggtggcgaacgtggagagagacaaatggctcttgatgagact
atgcttctgcttcttactaaggatttaataccagaaaccgttaggttctggaattttaaa
cctacaactttaacgctaggtagatttttggcagtaaaggattgggttaatgaggaagaa
ttgagacgttttaatttccccttaataagacgttttaccggtggtggtccggctttacat
gacgaaaatggtgaaattacttggagtgttgctatcaagggtaatgatttaatgaaggct
tatcaaactattgctaaagcgttaattaacgctctttctcattttgatttgaagggagag
ttttctccgataaatgatattgttgttcagggtaagaagattgttggaatggctggggct
attaagaggaattctattttagttcatggtacttttatgtatgctacaaacccagagttt
atgagggtcattaagtctccaaaggttaaggaggctgaaagaggtgaggctaagtctaga
gttactactgtttctttacttttgggttataatatatcaaggagtgaggctttagaggct
ttaattgagggttttaagtctgtttttaatcttgaggatggtgagttaactgacatagag
aaggagtttagtgaatcattaaggtttaaatatactaatcctcaatggacttatttgaga
tga

DBGET integrated database retrieval system