KEGG   Sulfurisphaera tokodaii: STK_11940
Entry
STK_11940         CDS       T00062                                 

Definition
(GenBank) hypothetical protein
  KO
K24689  lipoyl synthase
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00785  Lipoic acid metabolism
sto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    STK_11940
SSDB
Motif
Pfam: Radical_SAM FAM193_C
Other DBs
NCBI-ProteinID: BAB66235
UniProt: Q972D4
Position
1196485..1197312
AA seq 275 aa
MCQKMKVLLSSGTYYYLKRGIKVSETAYALQYGGCEGKCKFCTQSVLSNADKTYLSRVKW
YLVDFNDETAEKLSIFSRFCLQTVIKKGFVDEVIDILKLTRNKHKSVTITPIEVSYLYKF
KELNVDYLGVGLDTVKRLWDYVGKPYTFDEYMKFIKEAVRVFGRGHVYAHLIVGLGETDD
ELISLMKELKDIGAEVALFAFTPVKGTPFENLERPSLERYRHIQRMRYIIFEGKNSKLAY
LTSGCPSCDRPYYNEDPRDKLYNIPLRDFRWYMGS
NT seq 828 nt   +upstreamnt  +downstreamnt
gtgtgtcaaaaaatgaaagttctactttcttcgggtacttactactatttaaaaaggggt
ataaaggttagtgagactgcttatgctttacaatatggtggttgtgaaggtaagtgtaag
ttctgtacgcaatctgtcttatctaatgctgataagacttatttatctagggttaagtgg
tatttagttgattttaatgatgagactgctgaaaaactttccattttttcccgtttttgt
ttacaaactgtaataaagaagggttttgttgatgaggttattgatattcttaagcttact
agaaataagcataaatctgttaccataacccccatagaggtaagctatttgtataaattt
aaggagttaaatgttgactatttaggcgttggtttggatactgttaagaggctttgggat
tatgttggtaagccttatacttttgatgagtatatgaaatttataaaggaagctgttaga
gtctttggaaggggtcatgtttacgctcatttaatagttggtcttggtgagactgatgat
gaattaattagtttaatgaaagagttaaaagatattggtgctgaggttgctttgtttgct
tttaccccggttaagggtactccttttgagaatttagagagaccttctcttgaaaggtat
aggcacattcaaagaatgagatacataatatttgagggaaagaattctaagcttgcatac
ctaacatctggttgtccatcttgtgacagaccttattataatgaagatcctagagataag
ttgtataatattcctttgagggatttccgttggtatatgggttcgtaa

DBGET integrated database retrieval system