KEGG   Sulfurisphaera tokodaii: STK_11960
Entry
STK_11960         CDS       T00062                                 
Symbol
nadB
Name
(GenBank) L-aspartate oxidase
  KO
K00278  L-aspartate oxidase [EC:1.4.3.16]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00250  Alanine, aspartate and glutamate metabolism
sto00760  Nicotinate and nicotinamide metabolism
sto01100  Metabolic pathways
sto01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STK_11960 (nadB)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    STK_11960 (nadB)
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.16  L-aspartate oxidase
     STK_11960 (nadB)
SSDB
Motif
Pfam: FAD_binding_2 DAO Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like NAD_binding_8 Pyr_redox FAD_binding_3 FAD_oxidored Pyr_redox_3 Trp_halogenase ApbA
Other DBs
NCBI-ProteinID: BAK54476
UniProt: Q972D2
Structure
Position
1198164..1199582
AA seq 472 aa
MIYIIGSGIAGLSAGVALRRAGKKVTLISKRIDGGSTPIAKGGVAASVGSDDSPELHAQD
TIRVGDGLCDVKTVNYVTSEAKNVIETFESWGFEFEEDLRLEGGHTKRRVLHRTDETGRE
IFNFLLKLAREEGIPIIEDRLVEIRVKDGKVTGFVTEKRGLVEDVDKLVLATGGYSYLYE
YSSTQSTNIGDGMAIAFKAGTILADMEFVQFHPTVTSLDGEVFLLTETLRGEGAQIINEN
GERFLFNYDKRGELAPRDILSRAIYIEMLKGHKVFIDLSKIEDFERKFPVVAKYLARHGH
NYKVKIPIFPAAHFVDGGIRVNIRGESNIVNLYAIGEVSDSGLHGANRLASNSLLEGLVF
GINLPRYVDSSWEGISTDDGIVHSVRISGNKTLSLKEIRRINWENVGIIRNEEKLVKAIN
TYSSSTQNEAIISYLTALAAEIRKESRGNHFREDYPYKDPNWEKRIYFKLVV
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgatctatataattggttcaggtattgctggtttatctgctggtgttgcgttaagaagg
gctggaaagaaagttactttaataagtaaaagaattgatggtggttctactcccatagct
aagggtggtgttgcagcttctgttggaagcgatgatagtccagagctacatgctcaagac
actattagggttggtgatggattgtgcgatgtaaagactgttaattatgttacatctgag
gctaagaatgttatagagacttttgagagttggggttttgagtttgaggaggatttaagg
ttagaaggaggtcatacaaagaggagagttttgcataggactgatgagacgggaagagag
atattcaactttttattaaagcttgctagggaggaaggaattcccataattgaggataga
cttgttgagataagggttaaagacgggaaggttactggttttgttacggaaaagaggggt
ttggttgaagatgttgataaacttgttttagctactggtggttattcttatctttatgaa
tactcttctactcaatctactaatattggggatggtatggctattgcttttaaggctggg
actatacttgctgatatggagtttgtacaatttcatcctactgttacaagtttagacgga
gaagttttcttactaacagaaactttaaggggtgagggagcacaaatcattaatgagaat
ggagaaaggtttttatttaattatgataagagaggagaattagcacctagggatattctt
tctagggctatttatattgaaatgttaaagggacataaggtttttattgatttgagtaaa
attgaggattttgaaagaaagttccctgttgttgctaagtatttagctaggcatggtcat
aattacaaagttaagattcctatatttcctgcagctcattttgttgatggaggtattagg
gttaatattagaggggaaagtaatattgtaaatctttatgctattggcgaggttagtgat
tctggtttacatggtgctaataggttagctagtaattctcttttagaaggtttggttttt
ggcattaatttgccaagatatgttgatagtagttgggagggaatatctactgatgacggt
attgttcattctgttaggatatctggtaataagactctgtctcttaaagagataaggagg
atcaattgggaaaatgttggtataataaggaatgaggagaaattggttaaggctataaat
acttattctagttctacgcaaaatgaggctattatatcttatttgaccgcattagctgct
gaaataagaaaggagagtaggggtaatcattttagggaggattatccttataaggatcct
aattgggaaaaaaggatttattttaagttagttgtttag

DBGET integrated database retrieval system