KEGG   Sulfurisphaera tokodaii: STK_11980
Entry
STK_11980         CDS       T00062                                 
Symbol
nadC
Name
(GenBank) quinolinate phosphoribosyltransferase
  KO
K00767  nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC:2.4.2.19]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00760  Nicotinate and nicotinamide metabolism
sto01100  Metabolic pathways
sto01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    STK_11980 (nadC)
Enzymes [BR:sto01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.19  nicotinate-nucleotide diphosphorylase (carboxylating)
     STK_11980 (nadC)
SSDB
Motif
Pfam: QRPTase_C QRPTase_N CCDC73 TMP-TENI CutC Ribul_P_3_epim cwf21
Other DBs
NCBI-ProteinID: BAK54478
UniProt: F9VNX0
Position
complement(1200573..1201403)
AA seq 276 aa
MIKQIMINKLLSLLEEDTYPEDVTSKIVSGIKCKAIIISKDEGILAGQKFIIPFLEYLGI
KIENYMKDGTQIKKKDIVLEIEGDAETILGVERLVLNLLGKLSGISTVTHLMTRLAKSVN
PYVRIAGTRKTTPGLRVFEKYAIEVGGGDPHRFNLSDAVLIKDNHIALIGSVKEAIRRAK
EITSFTKKIEVEVSSLKDALEAYQAGADAILLDNMKPEEIIPVVNELKGKVIVEASGGIN
PDNVIEYAKTGVDIISSGYITHSSRSLDFSLDVYKS
NT seq 831 nt   +upstreamnt  +downstreamnt
atgataaaacaaataatgataaacaaactcttatcattacttgaagaagacacataccca
gaagacgtgacaagtaaaatagtttctgggataaaatgtaaagccataataatatctaaa
gatgagggaatattagccggtcaaaagttcattattcctttcttagaatatttaggaata
aagatagaaaattatatgaaagatggaacacaaataaagaaaaaagatatagtattagag
atagaaggagacgcagaaacaatcttaggagtagagagattagtactgaatctattaggc
aaattatctggtatatctacagtaacccacttgatgacaagactggctaagagtgtaaac
ccttatgttagaatagctgggaccaggaaaacaactccaggtttaagagtatttgaaaaa
tacgcaattgaagtaggtggaggagatcctcacagatttaatctttccgatgcagtgtta
ataaaagataatcacattgctctaatcggaagtgtaaaagaagctataaggagagctaaa
gaaataacaagttttactaaaaaaattgaggttgaagtatcaagtttaaaagatgcatta
gaagcatatcaagctggtgcagatgctatacttttagataatatgaaaccagaagaaata
ataccagtagtaaatgaattaaaagggaaagtaatagtagaagcttctggcggaataaat
ccagataatgtaattgaatatgcaaaaacgggggttgacattatttcaagtggttatata
acccatagttcaaggtcattagacttctctcttgatgtatataaatcataa

DBGET integrated database retrieval system